CAZyme Information: MGYG000001445_02353

Basic Information

• Species: Cedecea davisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Cedecea; Cedecea davisae
• CAZyme ID: MGYG000001445_02353
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000001445_1|CGC30	22459.57	8.8102

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001445	4852695	Isolate	not provided	not provided

• Gene Location: Start: 2567501; End: 2568112 Strand: -

Full Sequence      

MKLRWFIVLVLFLAGCSSHSPQQQAPWDPTIPTQRALTWMPLTEQSGQQWGVSPRLITAI
IAVESGGNPQLVSGSNAIGLMQIKASTAGKDVYRNQGFSGQPSNSELRDPARNIDIGTAY
LSILEHGILRGINDPQVMQYALIVSYVNGAGALLRTFDSDRQDAIDKINRLSPDEFYRHI
ETNHPAPQAPRYLYKVTRAMNAI

Enzyme Prediction     

No EC number prediction in MGYG000001445_02353.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	52	201	4.2e-17	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	4.39e-121	1	203	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	7.14e-85	41	201	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	8.12e-67	27	199	174	352	membrane-bound lytic murein transglycosylase MltC.
COG0741	MltE	7.41e-31	35	199	135	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.65e-27	47	168	5	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX97523.1	2.44e-148	1	203	1	203
AIR07239.1	9.18e-144	1	203	1	203
VEB97230.1	8.81e-142	1	203	1	203
ATF92266.1	1.25e-141	1	203	1	203
AIR62660.1	3.45e-139	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HJY_A	1.64e-86	11	203	15	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
3T36_A	6.02e-86	17	203	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
2Y8P_A	1.27e-85	26	203	9	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	3.64e-85	26	203	9	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	3.64e-85	26	203	9	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	8.08e-107	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A4WBE8	1.27e-103	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
A8AFS5	1.04e-102	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5XQ85	6.36e-97	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=emtA PE=3 SV=1
Q8XGT6	9.03e-97	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhi OX=90370 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000067	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001445_02353.