CAZyme Information: MGYG000001443_06409

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_06409
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182		19084.48	7.4172

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 155854; End: 156402 Strand: -

Full Sequence      

MRTTTLIPRRIATTGITVLGAAGIATAALTGTAHAQAPAKPADKVLSADSATAAEHVATQ
AAHAKAAKDGKKAEDYPDNLDGWIREAMSIMKKHGIPGSYDGIKRNIIRESGGDPGAVND
WDINAQKGIPSKGLLQVIQPTFDQYHVKGTADKLTDPVANIVAACNYAADRYGTMDNVDS
AY

Enzyme Prediction     

No EC number prediction in MGYG000001443_06409.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13402	LT_TF-like	7.55e-30	101	174	2	74	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG3953	SLT	4.70e-17	84	178	1	94	SLT domain protein [Mobilome: prophages, transposons].
pfam01464	SLT	1.61e-04	107	177	18	83	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd00254	LT-like	0.006	107	167	7	59	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam18896	SLT_3	0.008	110	174	24	82	Lysozyme like domain. This entry represents a lysozyme like domain found in candidate phyla radiation bacteria. The domain contains several conserved cysteine and histidine residues suggesting that it may bind to zinc.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID34458.1	1.13e-118	1	182	1	183
QID39568.1	1.75e-96	1	182	1	179
QID34829.1	3.01e-94	1	182	1	186
QID39180.1	4.28e-94	1	182	1	186
QID34892.1	3.63e-78	13	182	11	214

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54334	1.36e-12	79	178	1093	1189	Phage-like element PBSX protein XkdO OS=Bacillus subtilis (strain 168) OX=224308 GN=xkdO PE=4 SV=2
P45931	1.38e-12	79	178	1345	1441	Uncharacterized protein YqbO OS=Bacillus subtilis (strain 168) OX=224308 GN=yqbO PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001058	0.986114	0.000469	0.011786	0.000318	0.000212

TMHMM  Annotations     

start	end
12	34