CAZyme Information: MGYG000001443_04261

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04261
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
182	MGYG000001443_5|CGC18	19632.23	10.3917

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2104730; End: 2105278 Strand: +

Full Sequence      

MRDKSSKKHTPRSRRKLAALTGAGLAPLMVLGLTATPASAHGWVTNPASRQAQCATGVVQ
CGQIKWEPQSVEGPKGLKDCAGGNSRFADLRDDNKGWRVTDVGSSATFNWRLTAKHATTT
WQYFIGNTKLAEFNDHGAIPGEFVSHNVGFKGFTGKQKVLAVWNIADTANAFYACVDVNI
RG

Enzyme Prediction     

EC	1.-.-.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	41	179	1.1e-24	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21177	LPMO_AA10	4.60e-43	41	179	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	2.10e-35	15	182	5	209	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
PRK13211	PRK13211	4.47e-35	25	182	8	195	N-acetylglucosamine-binding protein GbpA.
pfam03067	LPMO_10	1.23e-28	41	178	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39253.1	1.29e-135	1	182	1	182
QNF54029.1	7.50e-103	14	181	4	171
QHF95739.1	4.34e-102	14	181	4	171
AXK34923.1	3.32e-90	14	180	4	170
AQY20219.1	6.92e-90	14	182	4	172

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA7_A	8.27e-43	41	178	1	139	Structuraland functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5AA7_B Structural and functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5VG0_A Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG0_B Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG1_A Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603],5VG1_B Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603]
2BEM_A	8.55e-30	41	180	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	4.80e-29	41	180	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	7.37e-28	41	180	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
5FTZ_A	7.97e-28	41	178	1	170	AA10lytic polysaccharide monooxygenase (LPMO) from Streptomyces lividans [Streptomyces lividans 1326]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3KIM2	2.97e-78	15	182	5	172	Lytic chitin monooxygenase OS=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) OX=278992 GN=SAM23877_0645 PE=1 SV=1
Q8EHY2	1.73e-23	16	179	3	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q838S1	3.86e-19	20	181	16	194	Lytic chitin monooxygenase OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0362 PE=1 SV=1
B5ESR7	3.34e-15	39	182	22	206	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q5E183	3.34e-15	39	182	22	206	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001829	0.653210	0.000296	0.343660	0.000769	0.000214

TMHMM  Annotations     

start	end
17	39