CAZyme Information: MGYG000001443_04139

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_04139
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
171	MGYG000001443_5|CGC14	18457.66	7.3728

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 1973764; End: 1974279 Strand: +

Full Sequence      

MHKKRKLAAVIGAGLSPLFVLGLSVSPASAHGYISDPASRQAQCAAGVVECGSIKYEPQS
VEGPKGLKDCAGGHDEWAELRDANRGWNVANVGKTATFSWTLTAPHRTTTWEYFIDGQKI
AEFDQGGQQPPNHLSHQVDFKNFSGRQTVLARWNVADTANAFYACVDVNIG

Enzyme Prediction     

No EC number prediction in MGYG000001443_04139.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	31	169	1.1e-26	0.9943820224719101

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd21177	LPMO_AA10	1.18e-44	31	169	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
PRK13211	PRK13211	1.86e-36	1	171	1	194	N-acetylglucosamine-binding protein GbpA.
pfam03067	LPMO_10	4.07e-34	31	168	1	186	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
COG3397	COG3397	7.39e-31	2	171	4	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID39160.1	1.36e-127	1	171	1	171
QHF95833.1	5.90e-111	1	171	1	171
QNF54130.1	5.90e-111	1	171	1	171
QHF95739.1	2.05e-88	1	170	1	170
QNF54029.1	4.13e-88	1	170	1	170

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AA7_A	5.94e-50	31	168	1	139	Structuraland functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5AA7_B Structural and functional characterization of a chitin-active 15.5 kDa lytic polysaccharide monooxygenase domain from a modular chitinase from Jonesia denitrificans [Jonesia denitrificans],5VG0_A Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG0_B Room temperature X-ray crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase at 1.1 angstrom resolution. [Jonesia denitrificans DSM 20603],5VG1_A Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603],5VG1_B Neutron crystallographic structure of a Jonesia denitrificans lytic polysaccharide monooxygenase [Jonesia denitrificans DSM 20603]
2BEM_A	4.77e-29	31	170	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
5FTZ_A	7.95e-28	31	168	1	170	AA10lytic polysaccharide monooxygenase (LPMO) from Streptomyces lividans [Streptomyces lividans 1326]
2BEN_A	1.07e-27	31	170	1	168	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
5WSZ_A	5.82e-27	31	170	1	166	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A3KIM2	1.51e-75	1	171	1	171	Lytic chitin monooxygenase OS=Streptomyces ambofaciens (strain ATCC 23877 / 3486 / DSM 40053 / JCM 4204 / NBRC 12836 / NRRL B-2516) OX=278992 GN=SAM23877_0645 PE=1 SV=1
Q8EHY2	4.51e-20	28	169	25	194	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
B5ESR7	9.38e-18	26	168	19	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q5E183	9.38e-18	26	168	19	202	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1
Q87FT0	1.73e-17	30	168	23	199	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000323	0.999022	0.000152	0.000191	0.000149	0.000144

TMHMM  Annotations     

start	end
7	29