CAZyme Information: MGYG000001443_03671

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_03671
• CAZy Family: GT76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
425	MGYG000001443_5|CGC8	47910.96	10.6616

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 1426927; End: 1428204 Strand: -

Full Sequence      

MPVLQPSRRKRDPGPSPHPAERRPDSPQTAPEDEPGARSSPAALPQHLLRRLRPADREVL
WLYLLTRAGIWITAYCTRWLFPDDGDTRSPAPLLAPFLHWDSVRYLYIARDGYFPGQAGP
WRGDWDNREAFFPGFPLLLRAVHALVPDWTLAGLLISFVAGAVAVVALARIAEWYLPGTR
AGGRTVLFFLLSPSAIFLAAGYTEALFLAFALPAWLAALRRNWQAAAVLTALATTVRVSG
LFLAAAVGLHFLLTVREHRRWRALPWLVLPALPVAVYHLFLRVHTGDWMAWKHAQERGWY
RDFHTPWEAWANTWRGAFGHSQTTGYAFMLQAELAAMAVGLLLLGLLLWRRRWPEAACIG
LSLWALGTSYWYMSIPRAMLLWWPLWIALAAVSLRRPWAKSAYLCLVGPLTTVFALTFLT
GRWAG

Enzyme Prediction     

No EC number prediction in MGYG000001443_03671.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	91	276	1.4e-23	0.44963144963144963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04188	Mannosyl_trans2	3.99e-05	93	214	53	175	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJT63078.3	1.23e-191	80	425	1	346
QSS91507.1	2.77e-186	59	425	1	377
QRV56160.1	1.12e-185	59	425	1	377
QLG32847.1	1.85e-184	59	425	1	377
QES17089.1	5.82e-183	51	425	31	405

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7TPN3	4.09e-09	74	253	40	214	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
Q5KR61	6.88e-08	52	241	4	207	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
Q9NUD9	3.74e-07	93	241	59	207	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999955	0.000068	0.000004	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
59	81
150	172
185	207
227	249
262	281
327	349
356	373
378	395
402	424