CAZyme Information: MGYG000001443_02862

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02862
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
894		100323.84	8.6387

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 460656; End: 463340 Strand: -

Full Sequence      

MSDTIPEELARGLRFLPEADEEERTAFLAAARDHWKDDAAGLDRLPPAERLAWTLVRQGR
LDEAVALQHFQRSHPGGFHVRGLRRTRAVFPEVGQIPLNGRKDLPVHSKLTALEWQPDGR
LRVRGWAYVANVPMAQQPKLPRFGLLWRKGSRRRTPFTVRAVRMPEATAASKQALHCYDW
SGFEFVLDPEKLPGSGRPGVWQLGLILPGPGGPHGVRPVKNVVGSGGHTQVRHVSDGRRL
VAGFDSKGRLQITLDAVPAEISGHRKDGSVLELTVRRHGTGVTALQIGDHHYPVAEDGTA
RVPLARLHEVETPYGKTHDWHCHLLLADGGKRRATVSADFAAGSWDLPGGREIALTTDGP
GLLKMHDRARQPVVDSLSWTAEGALVLEGEFGGPGEGARLVLRHGGQHEEKHLPLEYDPA
TRRFRASVQPLETATYDPDVTLPLRKGRWYFAIRAAGVTTHRKDVPVKLRADMVGRLPLE
HEASGRSFRVERRYFDRIYLEVESPLGEDERGAYRQHLLRTEFTEQHKKLPLRDAVFYNS
FGGKQFSDSPRAIHEELVRRGVEVEHLWSVADGQVALPEGVTPLEWHSKEWYEALARSRY
VVTNVGLGDWFTKREGQTVVQTWHGTPLKKIGADLLGTPKANRAYIASLPHRFRQFDITV
SPNAFTTPVMKRAFCAEGEVLEAGYPRNDLFHSPERAAIATRVRKVLGIPADKKVVLYAP
TWRDDQRHGGQRFKLDLKVDLAAAERELGDDHVFLFRKHPKILDAIPGAGEGFVFDVSGY
PDIAELYLIADVLITDYSSVLFDFAHSGRPMLFFTYDLEHYRDTLRGFYFDFTERAPGPL
IKTSEELVAAIRDIDAVAEAHKDRYADFVRDFCEPSDGLATARVVDRMLELGRR

Enzyme Prediction     

No EC number prediction in MGYG000001443_02862.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	8.60e-116	533	890	4	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	1.09e-83	530	891	22	387	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXK36357.1	2.19e-240	13	889	288	1283
AQU68459.1	8.33e-224	16	888	276	1166
QES41912.1	1.05e-223	13	889	275	1167
AZM53565.1	1.19e-222	13	889	278	1180
QES27553.1	1.64e-222	13	889	275	1167

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	5.33e-70	488	886	319	712	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	4.90e-69	488	886	319	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.27e-68	488	886	319	712	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	8.35e-82	533	890	381	744	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q2G1C1	7.60e-78	516	884	11	383	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKI5	1.64e-71	536	889	34	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
Q5HLM5	2.53e-69	488	886	319	712	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q8RKJ2	3.16e-32	614	889	335	604	Teichoic acid poly(ribitol-phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000046	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_02862.