CAZyme Information: MGYG000001443_02627

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02627
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243	MGYG000001443_5|CGC2	25732.44	8.8893

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 188689; End: 189420 Strand: +

Full Sequence      

MLEGNRVTARISVRGFAVASATAVTTVGAVVGVAAGADQGQASDVEATAAQATLLEDIPA
GSQAQVQTASLTQQAEHASAAAQAKAKKSAEEAARKQAAKDAAAKKEKAEKEAAAKDAAE
KAKERDKIKSASSRSEERPDFTQKSSYTTAEVQSMAKQIVGADQYQCFSEIVSRESGWNY
RATNASSGAYGLVQALPGSKMASAGADWRTNPATQIKWGLNYMNSRYDSPCGAWQFWQAN
HWY

Enzyme Prediction     

No EC number prediction in MGYG000001443_02627.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01464	SLT	9.93e-05	175	234	22	85	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13402	LT_TF-like	0.001	171	234	7	79	lytic transglycosylase-like domain of tail fiber-like proteins and similar domains. These tail fiber-like proteins are multi-domain proteins that include a lytic transglycosylase (LT) domain. Members of the LT family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, and the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL). LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13925	RPF	0.004	171	214	6	48	core lysozyme-like domain of resuscitation-promoting factor proteins. Resuscitation-promoting factor (RPF) proteins, found in various (G+C)-rich Gram-positive bacteria, act to reactivate cultures from stationary phase. This protein shares elements of the structural core of lysozyme and related proteins. Furthermore, it shares a conserved active site glutamate which is required for activity, and has a polysaccharide binding cleft that corresponds to the peptidoglycan binding cleft of lysozyme. Muralytic activity of Rpf in Micrococcus luteus correlates with resuscitation, supporting a mechanism dependent on cleavage of peptidoglycan by RPF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID37977.1	5.65e-122	8	243	2	237
QNF55444.1	1.63e-89	8	243	2	242
QHF97170.1	1.63e-89	8	243	2	242
QUI33610.1	1.01e-84	1	243	1	248
AYA17004.1	1.11e-84	1	243	4	251

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.495235	0.409168	0.071540	0.015921	0.006319	0.001807

TMHMM  Annotations     

start	end
13	35