CAZyme Information: MGYG000001443_02412

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02412
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1524		170959.53	9.8825

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2903189; End: 2907763 Strand: +

Full Sequence      

MPRFSVIVPVHQVQAYLRECLDSVLGQCFGDFELIAVDDCSPDACGQILDAYAAADPRVT
VIHLAQNSGLGPARNTGTARARGDYVLYLDGDDVMVPGALRAVADRLAATGEPDVLLFDH
APWYWDREPVAAHPDVLAPGAHPEVFTLADRPELLRLPAFAWTKAYRRDFLTREGFAFPP
GWYEDTPWTFPVLLTARTLATLGRVCVHYRQRRGGSILSSTSRAHFDVFAQYDRLFAFLE
DRPALARWRPALHRRMTDHFAVIHSSPGRLPRGDRAAFLRQARAHCRRHRPAPGSARQPL
GARTRLRHLLVRRGAHRTFRLLWQADRARTAVAARLRVLRPRARAALLQAHYALQRRRRL
DENLAVFSAYWNRGYSCNPAAIEAKVRELAPHVRTAWVCEPRYAHTVPPGVRHLRPGSAA
HWTALARARFLVSNVNLHHRYVKRPGQTLLQTHHGTPLKHMGLDLAPYPAAAAGMDFGRL
LRHADRWDYSLSANPHSTLVWERAYPSSYTTLEFGYPRTDVFQTATAADVARARARLGIP
EGAVAVLYAPTHRDHRPGRRPPLDVARLAAGLGPGFVVLVRAHYFHDGDRPPCLPPGVVD
VTHHPSVEELCLASDVLVTDYSSLMFDYAGLDRPLVVHAPDWDAYRDARGAYFDITAPAP
GPVTRDDDELLHVLATGAHATEEARRRRAAFRERFCPWDDGHAAERVVRAVFLGETPAAA
PRTGRAVPAADPPVVPLAERRPAPAPGAAPPRPALPRHPCPPRSEGLVVMPRFSVVIPVF
NVQGYLRECLDSVLGQSFTDLEVIAVDDRSPDHSGAILDEYAARDPRLTVLHLRENGGLG
PARNAGVRHARGDYLLFLDSDDRYLPGALAAVHRQLTACGEPDLLVFDHQRSWWDGRTEP
SSYGARLAATGTQTSSVADRPELLHLFHVAWNKAYRRAFYLREGLGFRPGLYEDAPLSHE
AMVCAGSIGCLPRICVDYRQRHQGAITRSPGRRHFDIFPQYDSLFAFLDRRPELAGHRPL
LFERMAAHLVFCLRRPERVRRADRRAYFRQAAAHYRRHRPPGFAPPPGSGRDLALLARGN
YPLFAARETVRRAGGLGRRGVRAARRRLSAGGNRLYYALQRRLPLQPDLAVYAAYWYRAP
ACNPQAVEAAARRLAPHVRSVWIVRPEAVAALPPGTDHVLPGTRRYWKVLARGTYFVNNV
NFPDHLVKRRGQVHVMTHHGTPLKTMGLDQRPYPAARMDFDALLRRASRWDYSVTSNPHS
AEVWHRAFPCGYRDLPAGYPRNDRYATAGPEQIAGIRERLGIPEGRTVLLYAPTARDYRE
GYLPDLDLEAFSSRLGDQYVVLVRTHYFYGRHEWLRELHERGLVRDVSRHPSTEDLCLAA
DALITDYSSLMFDYACLDRPLVVHAPDWDSYRDARGTYFDLLSGRPGETPGPVTRTVDEL
VAVFCDGTWRNDRSRALRAAFRERFCPWDDGHAAERVVRAVFLGETPALPPVPRRTAPLL
RASAMLPDPHRALGTPLRQPTDGG

Enzyme Prediction     

No EC number prediction in MGYG000001443_02412.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	774	872	3.7e-33	0.5823529411764706
GT2	5	112	1.6e-32	0.6352941176470588

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam04464	Glyphos_transf	2.56e-138	1124	1483	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
pfam04464	Glyphos_transf	9.80e-125	359	713	1	360	CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase. Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of gram-positive bacteria. They consist of a main chain of phosphodiester-linked polyols and/or sugar moieties attached to peptidoglycan via a linkage unit. CDP-glycerol:poly(glycerophosphate) glycerophosphotransferase is responsible for the polymerization of the main chain of the teichoic acid by sequential transfer of glycerol-phosphate units from CDP-glycerol to the linkage unit lipid.
COG1887	TagB	3.36e-56	1113	1482	12	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
COG1887	TagB	5.39e-48	359	712	23	385	CDP-glycerol glycerophosphotransferase, TagB/SpsB family [Cell wall/membrane/envelope biogenesis, Lipid transport and metabolism].
pfam00535	Glycos_transf_2	1.60e-35	774	869	1	96	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID40111.1	0.0	770	1524	1	755
QHF93212.1	0.0	770	1498	1	736
QNF56999.1	0.0	1	745	1	743
QHF93213.1	0.0	1	745	1	743
AXK36356.1	0.0	770	1492	1	725

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3L7I_A	5.61e-45	770	1477	1	710	Structureof the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_B Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_C Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A],3L7I_D Structure of the Wall Teichoic Acid Polymerase TagF [Staphylococcus epidermidis RP62A]
3L7J_A	4.22e-44	770	1477	1	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7J_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7K_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_A Chain A, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7L_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
3L7M_A	1.00e-43	770	1477	1	710	ChainA, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_B Chain B, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_C Chain C, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A],3L7M_D Chain D, Teichoic acid biosynthesis protein F [Staphylococcus epidermidis RP62A]
5HEA_A	1.67e-20	774	880	8	113	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]
3BCV_A	2.07e-19	1	93	4	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13485	1.14e-46	1117	1485	371	746	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus subtilis (strain 168) OX=224308 GN=tagF PE=1 SV=1
Q5HLM5	2.82e-44	770	1477	1	710	Teichoic acid poly(glycerol phosphate) polymerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=tagF PE=1 SV=1
Q2G1C1	9.73e-44	1178	1482	78	388	Teichoic acid glycerol-phosphate transferase OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=tarF PE=1 SV=1
Q8RKI5	6.38e-41	1123	1482	27	393	Teichoic acid poly(glycerol phosphate) polymerase OS=Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) OX=655816 GN=tarF PE=1 SV=1
P71059	7.28e-28	769	1007	1	241	Uncharacterized glycosyltransferase EpsJ OS=Bacillus subtilis (strain 168) OX=224308 GN=epsJ PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001443_02412.