CAZyme Information: MGYG000001443_02254

Basic Information

• Species: Streptomyces albus
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Streptomycetales; Streptomycetaceae; Streptomyces; Streptomyces albus
• CAZyme ID: MGYG000001443_02254
• CAZy Family: CBM2
• CAZyme Description: putative bifunctional chitinase/lysozyme

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000001443_1|CGC25	36439.68	4.7495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001443	7820353	Isolate	not provided	not provided

• Gene Location: Start: 2725019; End: 2726071 Strand: -

Full Sequence      

MNRTTQTADRRRRTGRGARLLTGTAAAAVVAGGAFLLADDATAGEEPAAAARRPAGTPFA
PYVDTSLRPSFDLLDNARETGVEECQLGFVTSAGGACEPRWGGTQELTDNPVARQIPRLR
DEGGDVRVSFGGASGTELALACDSSDALAAAYGKVVDTFGLKKIDLDIEGAALPDTAAGE
RRAKAVAALQRSHPDLDVSYTLPVLPEGLTEPGVKLLENARADGVRISTVNVMAMDYGPS
YQGDMGEYATRAATAAHRQVATALGLGDAAAWKALAVTPMIGVNDVGGEVFEPADARQVK
AFADEHGLGRLSMWSATRDKPCPGGPKEQADPACSSIRQDPHAFTEAFTG

Enzyme Prediction     

No EC number prediction in MGYG000001443_02254.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06543	GH18_PF-ChiA-like	6.86e-124	57	349	1	294	PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain. Members of this domain family are found not only in archaea but also in eukaryotes and prokaryotes. PF-ChiA exhibits hydrolytic activity toward both colloidal and crystalline (beta/alpha) chitins at high temperature.
COG3469	Chi1	8.03e-04	107	187	82	159	Chitinase [Carbohydrate transport and metabolism].
cd02871	GH18_chitinase_D-like	0.001	115	174	65	124	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QID36470.1	1.08e-229	1	350	1	350
QHF93349.1	8.09e-155	55	350	64	359
QNF57131.1	3.28e-154	55	350	64	359
QPP08703.1	2.75e-134	55	350	56	351
AKL64779.1	1.41e-133	52	348	196	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DSK_A	1.74e-35	59	348	12	289	Crystalstructure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus],2DSK_B Crystal structure of catalytic domain of hyperthermophilic chitinase from Pyrococcus furiosus [Pyrococcus furiosus]
3A4W_A	9.17e-35	59	348	12	289	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4W_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus]
3A4X_A	2.49e-34	59	348	12	289	Crystalstructures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3A4X_B Crystal structures of catalytic site mutants of active domain 2 of thermostable chitinase from Pyrococcus furiosus complexed with chito-oligosaccharides [Pyrococcus furiosus],3AFB_A Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus],3AFB_B Crystal structures of catalytic site mutants of active domain 2 of chitinase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P13656	4.69e-45	59	348	589	891	Probable bifunctional chitinase/lysozyme OS=Escherichia coli (strain K12) OX=83333 GN=chiA PE=1 SV=2
O74199	5.27e-41	59	321	238	511	Endochitinase 11 OS=Metarhizium anisopliae OX=5530 GN=chi11 PE=1 SV=1
P14529	3.99e-40	80	350	64	323	Chitinase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=chiA2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.278563	0.678706	0.019372	0.019178	0.003523	0.000659

TMHMM  Annotations     

start	end
20	38