CAZyme Information: MGYG000001442_01727

Basic Information

• Species: Streptococcus sp000411475
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp000411475
• CAZyme ID: MGYG000001442_01727
• CAZy Family: GT1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		47592.77	6.1882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001442	1753973	Isolate	not provided	not provided

• Gene Location: Start: 63936; End: 65207 Strand: -

Full Sequence      

MKRIKIDVVIVPLSGHLYPTMNLLLPLLNNPQYEIRLFTGPQKKTVAEAAGFNVVTILEG
YVEEFEKAANNSEQLGILSAYHQLSASIDLINLVSDQLMKEWQKNRPDIVIADFITLSGG
LVADQLGIPWITTMATQFVLETTDGPPCLIGGMGSPKNAWESAVQFLGRKGTRLVKRIVS
FSFRDRLKRYNFRLYNQLDQETIYSPYSILGIGMKEVELKKGFPEHYKWVGPSGASVEAG
EDYPLDLSVFPNRKKVLVTCGTQLAWAKDNLIFQAKQLAKAHPDFHFFVTRGVGGEPFQC
ENLMENLSVVSYLPYKEYIPQMDYVIHHGGAGIFYQCIIYGKPALILPHDYDQFDYAVRG
VEAGVALTANKEDTRAIGLAFEKLIAKADWSELEILRQAAQSYHPTEILESEIHRLLADK
EKE

Enzyme Prediction     

No EC number prediction in MGYG000001442_01727.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	88	388	1.7e-17	0.7146596858638743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1819	YjiC	2.80e-24	3	423	1	405	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	1.45e-23	5	373	2	359	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
pfam04101	Glyco_tran_28_C	2.82e-07	256	402	2	151	Glycosyltransferase family 28 C-terminal domain. The glycosyltransferase family 28 includes monogalactosyldiacylglycerol synthase (EC 2.4.1.46) and UDP-N-acetylglucosamine transferase (EC 2.4.1.-). Structural analysis suggests the C-terminal domain contains the UDP-GlcNAc binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLF56223.1	1.28e-265	1	423	1	423
AMD97834.1	2.02e-262	1	423	1	423
ANR76225.1	4.55e-240	1	422	1	422
ATF57445.1	4.55e-240	1	422	1	422
QRO08088.1	6.46e-240	1	422	1	422

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	3.24e-11	1	379	1	344	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	3.30e-11	1	379	1	344	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
7LVY_A	2.50e-06	287	355	327	392	ChainA, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_A Chain A, UDP-glycosyltransferase 203A2 [Tetranychus urticae],7MCO_B Chain B, UDP-glycosyltransferase 203A2 [Tetranychus urticae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34539	1.81e-10	1	379	1	344	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	4.09e-07	11	379	11	349	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
P0DTE5	1.20e-06	73	379	118	432	UDP-glucuronosyltransferase 2A2 OS=Homo sapiens OX=9606 GN=UGT2A2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001442_01727.