CAZyme Information: MGYG000001442_01194

Basic Information

• Species: Streptococcus sp000411475
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus sp000411475
• CAZyme ID: MGYG000001442_01194
• CAZy Family: GT113
• CAZyme Description: Beta-1,6-galactofuranosyltransferase WbbI

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000001442_2|CGC1	39564.5	7.071

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001442	1753973	Isolate	not provided	not provided

• Gene Location: Start: 17117; End: 18172 Strand: -

Full Sequence      

MKYYLKEEFLHDNNAKNAGNKARNDVEEIVKKEGYQPLILSVDDWYQMNILKAQRHKAKA
FAQVLSQMNKGDILLIQFPMLHHSFFTTGLVKKAQKRGIKVYLLIHDLEVLRHANSTSLP
LKYRIRMHLQEGSLLKAADGIIAHNPVMKSVLVEKGIAEDKVISLEIFDYLIPNFQEKTI
QTKDQPIIVAGNLAQEKAGYLYALPEAPVYNLYGVGFDESRALVNETYFGSFLPDELPAA
LEGGFGLVWDGDSADTCSGLFGEYLRYNNSHKASLYLASGFPLVVWKQSALSHFVLENGC
GIAVESLHDLKKTIENLSDADYQILVEKSKYIGKKIRDGFYLTNALNELTK

Enzyme Prediction     

No EC number prediction in MGYG000001442_01194.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT113	12	349	3.8e-104	0.9813664596273292

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09814	PRK09814	1.01e-96	1	351	1	331	sugar transferase.
cd03794	GT4_WbuB-like	3.48e-12	50	319	78	361	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
pfam13439	Glyco_transf_4	0.001	72	174	74	164	Glycosyltransferase Family 4.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC34319.1	2.51e-210	1	349	1	349
ARC49781.1	7.99e-207	1	349	1	349
QKH69719.1	1.14e-206	1	349	1	349
AGY39025.1	2.29e-206	1	350	1	350
VED88100.1	7.63e-205	1	349	1	349

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37749	2.09e-47	9	349	3	323	Beta-1,6-galactofuranosyltransferase WbbI OS=Escherichia coli (strain K12) OX=83333 GN=wbbI PE=1 SV=1
Q9AEU1	2.12e-21	22	346	20	325	Glucosyltransferase 3 OS=Streptococcus gordonii OX=1302 GN=gtf3 PE=3 SV=1
B3XPQ7	1.54e-18	10	348	8	327	Glucosyltransferase 3 OS=Limosilactobacillus reuteri (strain DSM 17509 / CIP 109821 / 100-23) OX=349123 GN=gtf3 PE=3 SV=1
F8KEJ1	1.05e-17	10	348	13	332	N-acetylglucosaminyltransferase OS=Limosilactobacillus reuteri (strain ATCC 53608) OX=927703 GN=gtf3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001442_01194.