CAZyme Information: MGYG000001438_00671

Basic Information

• Species: Paenisporosarcina sp000411295
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales_A; Planococcaceae; Paenisporosarcina; Paenisporosarcina sp000411295
• CAZyme ID: MGYG000001438_00671
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000001438_1|CGC3	25733.13	4.6797

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001438	3493887	Isolate	not provided	not provided

• Gene Location: Start: 661044; End: 661730 Strand: +

Full Sequence      

MKKRKKMKRLSAVTRGLLIILMVPITMTLFVLTSVYWGDLQRIPIVHTLTESIQDAPKKM
MDMDIPEEYIPIYKEAAKEYEVPWTLLAAHHRIETKFSTMDPLLSPVGAEGHMQFMPCTF
VGWQHPSCSGQGKGDISKEDKTNPDVIAEYGGYGIDANEDGKADPYQLDDAIFSAANYLA
SNGAANGDLEHAIYMYNRSDEYVEDVLYYYHKYEEEQGTQGQAASSEQ

Enzyme Prediction     

No EC number prediction in MGYG000001438_00671.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	75	217	1.7e-16	0.8962962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13399	Slt35-like	9.81e-29	80	208	1	104	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
COG2951	MltB	2.08e-10	65	183	108	240	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
pfam13406	SLT_2	2.87e-07	105	183	151	200	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
cd13403	MLTF-like	4.08e-05	74	119	2	45	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	4.21e-05	74	197	2	93	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBP41036.1	1.56e-136	1	226	1	226
AYC29491.1	2.27e-102	1	216	1	215
QFF99099.1	7.13e-100	5	214	2	210
ALC85496.1	1.87e-96	5	214	2	211
QGM30192.1	1.65e-95	19	219	16	213

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.928102	0.007462	0.001136	0.000047	0.000031	0.063242

TMHMM  Annotations     

start	end
16	38