CAZyme Information: MGYG000001423_01603

Basic Information

• Species: Clostridium celatum
• Lineage: Bacteria; Firmicutes_A; Clostridia; Clostridiales; Clostridiaceae; Clostridium; Clostridium celatum
• CAZyme ID: MGYG000001423_01603
• CAZy Family: GH110
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1769		197821.28	4.3689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001423	3553421	Isolate	not provided	not provided

• Gene Location: Start: 63013; End: 68322 Strand: +

Full Sequence      

MRKIKNNVMKKTALLTSIFMAFSLILNSNKASAGIFKKENSIIIDVTDFGADPSGKKDST
EAIYEAIESAKEYNNEVIINFPKGEYQIYKDNAQKREYHTSNTNSMENPIKTIGILIEEQ
EDLTLEGNGSLFNMHGNMMAIAVVKSENVKLKNFSWDFEVPTTSEMTVLDIGVEDDKNYI
DYYIPSNFRYQIVDNNTNILWTSEESPYTGKYYWTQKGHHSNSYAVVIYDPEIEVSRRYQ
LSSSPFNGVNTITQLNENTVRIIYNNAIPYGQKIGVVNEMCTSAMRETAGAFIWESKDTV
LENINIHYMHGFGFLTQMSENVTFDTVNFMPREGTGKYTTSFADLIHVSGAAGKITIKNC
NFSHAHDDPINIHGTFTRVEEKIDSKTLKLKYIHSQQGGFPQYYVGNEVAFFTRDTLMSP
DNEEKMYTVKEVIQAGEEGNDLRTMIVTFNEELPSDIDEKIGDQPKYVAENATYTPELEI
VDNIFHTIPTRGILSTTRKSVLIEGNEFRNMGMATIYLSNDSANWYESGPIRDLTIRNNK
FYIRESGQIEWRFKSAIYINPVTLGGALPSAESPIHKNITIEDNEFYMEHDAVVNAESVE
NLTIRNNKVFRDNPNVQLNLSLDNTTLNENEKANLTLESTGTQISGNEENVFYFRGCKNV
ILEGNTYDDGLIKNAVVTNMPLDYITNSDDITLNGSTTPSMPVNNIKYVSLNPAVATVSA
SGEITAISSGEAEVLAYYVWNNTSIESNKVTVTVVGESLEKADSIEITNKDNSIIEKLSE
GIKFNAEVLPENLSNQIKWSVTNIDGTSTTKATIDESGLLTAKENGVIIVKASINGLEAS
KTVVISDEATSYIPSYVNIVNENSQNLTISENGESAIIKMERGDLYNSDNNIRNLVLIDV
PDSVSADDMRFTVKVDNLPLAESNRWDTASVLLFKDVDNYISLGKKSHYNGLVTVREVNA
SAIENDKSGSVNESTLIFDVYNKDGNVTISYKTPDGEYIEWGNLDSSFLGEDYKIGFAVW
NHDGRDKDVTFSNLKIATGSEYNKQEIEAIDSIKLKSTKNNKPTISDVTIENTSVKIGEE
LEVSYKYYDEDNHNEEGSIYKWETTSATGKTVEYTSSKTYIAKISGSITCTVYPRDQYNR
LGDPVVSNSVEVSENKVNGTLESIKINSIELSGFESEKYEYDYYLTNSQNNLILSGASNN
DSDNIKVTLNGEVIFDDIDKFSKEITLNNSGVITIEVDPVGLFKSKKVYTINVNKLVDNY
AKLDTISIEEMDINISDNINSYYHYNVNSDIKDITLRLSANERVGSIKVYETEYRREVIN
NSLDNNKFENNVTLASGNNLIFIEVTAKDGVTTSKYIINVARMPSRDATLSDIKINGDSI
DGFEKSKLEYTIKLTEEESKNITVEATANSYYSTISITNNNERVEANKKDVELKPGLNEV
VIACKADDLWTTNYYTLKILVSSDSNATLLSLETPNNNLDPIFESNKTEYSITTSKQDFE
LVAVAQEENATLEISINGNKLKATNKIEINEKLVAGENLVSIKVISPDKLQEKIYNINIT
ANEFVYLSDLNWNPESYVGYGTFNRDKAPNGGVITLLKDGDVKSFEKGIGAHAQSELIFD
IEGKGYERLQGFAGVDYSQATSLNGQVTFKVLLDGVEAFNSGEINGSSECKELDLELNGV
KEVRLIALSGLNNWNDHAVWADAKFLTTFDEVIPPVKDADYNDDGVIDIKDLGMASKNYG
KDIPQYDINNDNIIDKYEIQFIMDKILEK

Enzyme Prediction     

No EC number prediction in MGYG000001423_01603.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH110	43	620	2.6e-155	0.9653284671532847
CBM51	1565	1705	1.3e-34	0.9925373134328358

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam08305	NPCBM	1.63e-37	1565	1705	3	135	NPCBM/NEW2 domain. This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins. This domain has also been called the NEW2 domain (Naumoff DG. Phylogenetic analysis of alpha-galactosidases of the GH27 family. Molecular Biology (Engl Transl). (2004)38:388-399.)
smart00776	NPCBM	5.90e-29	1565	1705	5	144	This novel putative carbohydrate binding module (NPCBM) domain is found at the N-terminus of glycosyl hydrolase family 98 proteins.
cd14254	Dockerin_II	1.60e-06	1719	1767	1	54	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
pfam12708	Pectate_lyase_3	0.002	43	88	1	46	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
pfam12733	Cadherin-like	0.007	1479	1560	6	87	Cadherin-like beta sandwich domain. This domain is found in several bacterial, metazoan and chlorophyte algal proteins. A profile-profile comparison recovered the cadherin domain and a comparison of the predicted structure of this domain with the crystal structure of the cadherin showed a congruent seven stranded secondary structure. The domain is widespread in bacteria and seen in the firmicutes, actinobacteria, certain proteobacteria, bacteroides and chlamydiae with an expansion in Clostridium. In contrast, it is limited in its distribution in eukaryotes suggesting that it was derived through lateral transfer from bacteria. In prokaryotes, this domain is widely fused to other domains such as FNIII (Fibronectin Type III), TIG, SLH (S-layer homology), discoidin, cell-wall-binding repeat domain and alpha-amylase-like glycohydrolases. These associations are suggestive of a carbohydrate-binding function for this cadherin-like domain. In animal proteins it is associated with an ATP-grasp domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYE35188.1	0.0	3	1393	7	1396
QAS60591.1	0.0	3	1393	7	1396
ATD55583.1	9.61e-285	44	693	3	616
ATD56740.1	9.61e-285	44	693	3	616
QBJ75880.1	1.03e-284	44	693	5	618

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7JW4_A	1.79e-45	27	607	11	564	Crystalstructure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta],7JW4_B Crystal structure of PdGH110B in complex with D-galactose [Pseudoalteromonas distincta]
7JWF_A	7.79e-45	27	607	11	564	Crystalstructure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_B Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_C Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta],7JWF_D Crystal structure of PdGH110B D344N in complex with alpha-(1,3)-galactobiose [Pseudoalteromonas distincta]
7JS4_A	5.47e-26	1507	1760	552	797	ChainA, F5/8 type C domain protein [Clostridium perfringens ATCC 13124]
2VMH_A	4.37e-19	1559	1704	3	149	Thestructure of CBM51 from Clostridium perfringens GH95 [Clostridium perfringens]
2VMG_A	5.14e-19	1559	1704	9	155	Thestructure of CBM51 from Clostridium perfringens GH95 in complex with methyl-galactose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1V8K7	4.43e-122	33	757	24	726	Alpha-1,3-galactosidase A OS=Streptacidiphilus griseoplanus OX=66896 GN=glaA PE=1 SV=1
Q826C5	1.43e-111	18	611	14	585	Alpha-1,3-galactosidase A OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=glaA PE=3 SV=1
Q5L7M8	1.07e-85	46	678	28	592	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=glaA PE=3 SV=1
Q64MU6	1.07e-85	46	678	28	592	Alpha-1,3-galactosidase A OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=glaA PE=3 SV=1
Q8A2Z5	1.09e-80	77	610	46	533	Alpha-1,3-galactosidase A OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=glaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000343	0.998877	0.000262	0.000174	0.000166	0.000145

TMHMM  Annotations     

start	end
13	35