CAZyme Information: MGYG000001421_01234

Basic Information

• Species: Dielma fastidiosa
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Dielma; Dielma fastidiosa
• CAZyme ID: MGYG000001421_01234
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		26366.4	5.3381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001421	3575388	Isolate	not provided	not provided

• Gene Location: Start: 175347; End: 176042 Strand: +

Full Sequence      

MIKKLIRFILCLILAVVLIFTTLGYFQYKTAIQSISIEDKVAQIQADEKYVSLKQVSDYL
KDATVAIEDRRFYEHHGVDFIAWLRIAKDLIFTQQINSGGSTITQQLAKNMYFGYEPSLI
RKFSELFVVHDLESRYDKDTILELYINIINYGDNNFGIYDAAYNYYGVSPAELDLDQAST
LAGIPQSPAYLQLSNLTMKTIYKQKAVLSAMVKEGMITQAEMDAVMRNKGE

Enzyme Prediction     

No EC number prediction in MGYG000001421_01234.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	42	212	1.6e-53	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	4.92e-63	50	212	15	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	7.36e-63	13	227	47	256	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	2.66e-56	50	227	4	181	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG5009	MrcA	6.59e-52	2	226	1	245	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.62e-38	46	221	53	230	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCT44833.1	3.21e-71	2	227	5	230
QNM12078.1	1.24e-68	2	226	4	228
BBK21420.1	4.52e-66	3	222	5	224
BBK61494.1	9.07e-66	3	222	5	224
QSI25809.1	2.44e-64	2	227	4	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	6.07e-32	50	223	22	195	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	8.54e-32	50	223	22	195	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5ZZK_A	1.20e-28	39	226	48	241	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]
3HZS_A	1.40e-28	39	226	12	205	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.43e-28	39	226	13	206	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P02918	4.62e-31	51	223	69	241	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1
P39793	8.70e-31	40	221	86	269	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1
Q49YR9	1.28e-30	39	230	72	269	Monofunctional glycosyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=mgt PE=3 SV=1
O87626	5.30e-30	22	229	40	249	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
Q8CNQ3	6.80e-30	39	230	71	268	Monofunctional glycosyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) OX=176280 GN=mgt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.935854	0.034024	0.027448	0.000131	0.000076	0.002489

TMHMM  Annotations     

start	end
5	27