CAZyme Information: MGYG000001411_00151

Basic Information

• Species: Pauljensenia sp000308055
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Pauljensenia; Pauljensenia sp000308055
• CAZyme ID: MGYG000001411_00151
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599		66813.1	6.3386

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001411	1864179	Isolate	not provided	not provided

• Gene Location: Start: 183224; End: 185023 Strand: +

Full Sequence      

MDDKTLSDSDIPEDPTLGPNQASPAACSEPLPEAEEGEASPSAEVDKTSAEGEELDLTPE
GEDADATSEGTGREWKPVPIPKWARFPMSAQAGWIATLVTTLLAALIRLPGLGTIKTLVF
DETYYVKDAYSLMTLGYEGSWAKDNDPMFISGDYSGLSTNGGYVVHPSVGKWLISLGMRV
FGATNPVGWRISAAIAGIILVFLTARIAQHLFRSPAITALAGFFMATDGIAIVLSRTGLL
DIFLAMFAAAAFLAVLKDQEISHPRLIEKLSQWKPDPDNPSRIGPHAGARWWLLVAGILC
GLAMSVKWSGLYALAVLGLFVAFRDWMTRRRFGHPRAFYATLINDTSVAFLAMVPPAVIT
YVASWFGWFRHWNAYGHKTHGFIGAFHDLWDYHVGMLKFHTGLTTPHTYQAHPAQWFVQA
RPTSFAWNKIADASCDKSDCVNAVVALGNPLLWWFAAIAFFIVLFVTLRDRNWRTGFVVC
GYLAMYFPWYLNANRTIFNFYTIAFVPFVCLSAAWVIGLMLDQTRCEVNPDRMYDSQPLE
EGDYRWMGANVVTRQRFAIGAVIIVLLITAVSIFFMPLWRGDLISYNFWHIHMWLPTWI

Enzyme Prediction     

No EC number prediction in MGYG000001411_00151.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	100	369	5.1e-65	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	9.38e-17	76	326	8	228	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	1.28e-14	388	596	2	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
COG4346	COG4346	3.20e-12	166	509	136	401	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam02366	PMT	2.53e-11	101	326	4	201	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG1807	ArnT	4.83e-11	88	406	1	269	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT34948.1	8.81e-184	79	599	54	581
AKU65332.1	2.23e-182	92	599	70	584
QQC43974.1	3.16e-182	92	599	70	584
QGS11599.1	1.15e-181	79	599	54	581
QGH70911.1	5.49e-132	97	599	3	504

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L8F4Z2	3.01e-70	87	598	31	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1
P9WN04	1.11e-63	77	598	26	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	1.11e-63	77	598	26	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
Q8NRZ6	5.73e-58	82	598	29	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
90	112
186	208
212	234
239	256
291	323
347	369
451	468
475	492
497	519
557	579