CAZyme Information: MGYG000001408_01062

Basic Information

• Species: Brevibacterium senegalense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Brevibacteriaceae; Brevibacterium; Brevibacterium senegalense
• CAZyme ID: MGYG000001408_01062
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
285		29505.15	3.9257

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001408	3398887	Isolate	not provided	not provided

• Gene Location: Start: 493429; End: 494286 Strand: -

Full Sequence      

MRRPAKVFVAIAGMVSAGLAVGSGTLFLSLAGQAGQSQAQEQTQGPDDGRQEAAPDLPLL
PPADPAGRGELPQVVDSEWLDDTAEATGIPRRALQAYVGAAAWTTDRMPSCGLGWNTLAA
IGQVETNHGRVDGTRIQDSGDVSQPIVGVELSGGSGVRTIEDTDDGELDGDDRYDRAVGP
LQFIPQSWAVHGRDGNGDRTADPQNIDDAALSAAAYLCAGGSLNSPQGWENAVLSYNDSL
DYAEAVYGAAQSIAQAAGVERAAPAPVTVPASEEPEDDRRPGVSE

Enzyme Prediction     

No EC number prediction in MGYG000001408_01062.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	114	256	1.1e-18	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2951	MltB	2.21e-20	1	272	2	294	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
cd13399	Slt35-like	3.44e-20	111	252	1	108	Slt35-like lytic transglycosylase. Lytic transglycosylase similar to Escherichia coli lytic transglycosylase Slt35 and Pseudomonas aeruginosa Sltb1. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP04478.1	6.37e-80	1	284	1	280
QDW29606.1	1.46e-61	76	258	63	245
ALV42142.1	5.13e-60	76	258	65	247
BCW54478.1	5.13e-60	76	258	65	247
AOS61582.1	3.88e-59	40	252	84	286

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.724812	0.268530	0.002426	0.001274	0.000662	0.002297

TMHMM  Annotations     

start	end
7	29