CAZyme Information: MGYG000001402_01788

Basic Information

• Species: Coprobacillus cateniformis
• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelatoclostridiaceae; Coprobacillus; Coprobacillus cateniformis
• CAZyme ID: MGYG000001402_01788
• CAZy Family: GH140
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426		50232.03	5.8517

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001402	3861289	Isolate	not provided	not provided

• Gene Location: Start: 1799481; End: 1800761 Strand: -

Full Sequence      

MTLTIHKKNFIKDGKPFFYLADTCWSAFTNIPENDWHYYLQYRKRQGYNVLQINILPQWD
ASGTDLNYVPYVLKEDGGYDFTKINDDYFQHAKRMCEIAKEYNFELALVALWCNYVPKTW
ANNMLPLNTMPFDCVDRYIEKVDETFTQFNPIYIISGDTDLNEEITRNYYNKASDLLREA
APQCIQTLHVRGRLMEIPEEMINRMDFYMFQSGHNAKTENLCMTYRLPEYFVENYPGKPL
INSEPCYEQMGSSGRIYGRHHRFNIRRAAWQSLLSGACSGITYGAAGIYSWHIYGKNFGS
AIGEGFDMPNPWQQAIHYPGAWEYGDIKHIFNEFQVTELISKQKVLLNNTEEIRVACTPD
EKLMMIYLPENTTIKLNYHFSEDDECTIIDLNTLHRECGRIYNHKDICYLDMHVFEHDVL
YIIRRK

Enzyme Prediction     

No EC number prediction in MGYG000001402_01788.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	11	380	8.6e-103	0.866504854368932

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13204	DUF4038	2.04e-95	12	334	8	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCL56686.1	1.86e-199	1	426	3	426
AQR97273.1	8.07e-168	1	426	1	431
AGF58583.1	3.26e-167	1	426	1	431
AJH02030.1	6.88e-163	1	425	1	426
QNM10846.1	1.49e-161	1	424	2	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	2.69e-20	12	367	30	384	Glycosidehydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	7.24e-18	12	352	30	367	Crystalstructure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001402_01788.