CAZyme Information: MGYG000001391_03096

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_03096
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035		115134.95	4.5975

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 77940; End: 81047 Strand: +

Full Sequence      

MDVKKLLILIALTLPGWLLAQNYADYKLYASYNFEQGTAEDNQSNTSMELKGARIVDDPV
RGKVLSFDRVKSQYAVITPAPVIGDTLSLSFWYKRSSFDGDELWKQIFEFYSSTNGSNIY
LMPIYGYDDNSSGIVSCANKINNGIWEPLYGPRIEKDNTWHHIALVVAGVSWNYYLDGKK
VGSKKILAPISLLDLTHLYFGVNPDRSPHPSTGSIDDVNIYHYPLSASQVAQIYAGEAIT
EPLPEGPITFLFDNDLKEEGGRITIEGSGYSFEEDSQRGQVVKLEAGGQLQFSDNIIPDE
ASTLNFLYKKESIDDADHGKYIYRAFKDENNGYGLKIKVDGDAAYVVLETIVEGEKTETV
GSELLESGKWNAISVVHAVTPRIIIRVYQNGKQTAAKVAVNPYNLGLDKWFLGSTVASES
AGGLYDELMVDDYAMDVEDVAYYYSSTLMSPVEVTVDCSNKYQTIRNFGSSDAWNADWLG
RLWPEAKKNRLAELLFSKELDENGNPKGMGLSCWRFNIGSGSATQGDDAGMGDSKRTECF
LNPDGTYTWERQTGQLWFLRKAALEYGVEDLLGFMNSPPIYMTKHGYAYNKDNGSNYILA
EDKYDDYALFAAEVVDHFDKEGIHFDYISPMNEPQYAWAGGQEGSPATDQEIADVIKALS
SAFAAKQLTTQLTFAEAGFLGSAESQIPKFWGNEQPTMKVAGLPNVSNIVSAHSYWADQD
AQGMYDTRVNFRKAMDAVNPPLEYFQSEYSLLDGGYSWGHPGSEGGFSEIECAISLARML
HVDLVVANATGWHWWTTFESGSHYGESRFALIEAPTVEGLNDGFIHGTKLLYTLGQYSRF
VRPGMKRVEAKRSDNLSVVDALKNDMYSSYINEATQQVVIIATNSRTVKRPFTFKVENIS
GNTDLEFTPYVTSEDDNMKAYPKIKEGDVFTIPPLSVVTFVSGSGDISSVTTVKEEDKNR
DIHIQPNPVRDEATVSSGSSIKNVTLYDVYGKLVYRQSDINEKICKLSLSGLLPGMYVVK
VETDNGCKTQKMIKK

Enzyme Prediction     

No EC number prediction in MGYG000001391_03096.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	453	941	1e-152	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.15e-113	451	797	1	355	O-Glycosyl hydrolase family 30.
pfam13385	Laminin_G_3	6.71e-19	72	231	4	151	Concanavalin A-like lectin/glucanases superfamily. This domain belongs to the Concanavalin A-like lectin/glucanases superfamily.
pfam18962	Por_Secre_tail	4.34e-14	966	1033	3	71	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.
COG5520	XynC	6.20e-14	433	941	15	427	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
TIGR04183	Por_Secre_tail	2.59e-13	966	1035	3	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75064.1	0.0	1	1035	1	1042
QEC54450.1	1.50e-118	451	941	42	535
QMU29008.1	1.04e-113	451	941	31	526
ASU32951.1	7.03e-111	450	941	29	519
QEC64075.1	6.68e-110	451	941	29	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.69e-77	456	941	10	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
7O0E_A	4.11e-16	454	865	5	376	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7NCX_AAA	2.63e-15	454	865	12	383	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	8.59e-13	454	941	25	452	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]
6IUJ_A	8.05e-11	453	942	23	471	ChainA, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612],6IUJ_B Chain B, GH30 Xylanase B [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q1N4	4.74e-16	454	865	29	400	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000630	0.998298	0.000361	0.000232	0.000225	0.000220

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_03096.