CAZyme Information: MGYG000001391_01816

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_01816
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40747.96	9.9454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 380663; End: 381745 Strand: -

Full Sequence      

MVKNNCSVIFPRPLRNILIIRLSALGDVAMTIPVVYSLCEAYPDVNFTMLTTPVVSRIFI
NRPDNLKIYPAEIRGRHRGIKGIFVLYKELRPLSFDGIADLHNVLRSRLLCALLRLSGVK
SIHINKGRIAKCKITARRHKKLRQLPTSFHRYTDVFRKLGFSFPENFVSIYGKQKAALPE
ILLPEYSSEEHCIGVAPFAKHQGKIYPEKKMEQLISMLAKTGEYKIFLFGGGEKESLVLN
RWASDFPDKVVSLTDMKLGFSGELALMSHLKLLVSMDSANMHLASLVGLPVISVWGATHP
YAGFLGWRQSLDNVVQLDLPCRPCSIFGNRPCWRNDYACLNEISPEEIADKIKKEIYAQK

Enzyme Prediction     

No EC number prediction in MGYG000001391_01816.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	86	334	1.2e-34	0.9511111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	5.00e-51	16	354	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	2.04e-37	15	353	2	327	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
PRK10422	PRK10422	1.02e-13	13	317	4	306	lipopolysaccharide core biosynthesis protein; Provisional
pfam01075	Glyco_transf_9	1.09e-13	83	324	1	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	0.003	204	300	192	284	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64055.1	6.02e-136	14	360	6	351
AHF12543.1	4.34e-124	15	354	4	344
AVM58063.1	2.12e-116	16	356	2	340
QUT41273.1	1.90e-115	16	353	3	339
QUT73461.1	1.90e-115	16	353	3	339

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	4.35e-07	16	306	2	288	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	4.35e-07	16	306	2	288	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	4.48e-07	16	306	2	288	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	9.89e-11	26	316	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	3.23e-09	26	316	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
P24173	1.74e-06	16	318	2	308	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999982	0.000048	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_01816.