CAZyme Information: MGYG000001391_01372

Basic Information

• Species: Coprobacter fastidiosus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Coprobacteraceae; Coprobacter; Coprobacter fastidiosus
• CAZyme ID: MGYG000001391_01372
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521		56641.59	4.8621

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001391	3843461	Isolate	not provided	not provided

• Gene Location: Start: 538054; End: 539619 Strand: +

Full Sequence      

MTLSGILLCASICFISCGKDNETFSAGGNIDTSGNGNNNTQIQETAYAFPGAEGAGRNTT
GGRGGKIYYVTSLNDELSDNTTLRYALSRNEPRIIIFKISGTIKLKKELSIENGDVTIAG
QTAPGDGICLAGYPVMIKADNVIIRYMRFRLGDAQMKEDIAAGKIDPTYADGADAFGGTK
RKNIMIDHCSVSWCVDECASFYDNTNFTMQWCLISESLRLSLHSKEAHGYGGIWGGKNAS
FHHNLLAHHDSRNPRFNGSRMSALPDLEKVDFRNNVIYNWRGNSSYAGEGGSYNLVNNYY
KPGPATEKSSATVKYRIFAPNADLGEYSNGQMSGQWGTFYINGNYMGATTSTAQEANNVC
NDNWIGVHPDERNYSLPGGTISSIKSSVMFTDMGDATEVTTHSAENAYTRVCEYAGCSLV
RDAVDKRIINEVKNGTATYSGANYPGIIDSQETVGGWPTLNSTEPPVDTDGDGMPDEWEK
QVGLNPNSYNNPNAHTLSSGYTDIEVYLNSLVETITEAQNK

Enzyme Prediction     

No EC number prediction in MGYG000001391_01372.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	100	300	5.5e-82	0.994535519125683

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	1.50e-04	102	292	3	175	Amb_all domain.
pfam18884	TSP3_bac	5.85e-04	468	488	1	21	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.
COG3866	PelB	0.006	67	255	56	235	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82553.1	1.41e-180	38	519	113	559
QNL41084.1	3.00e-173	7	515	9	521
QRQ55767.1	9.13e-173	7	515	9	523
SCV08375.1	9.13e-173	7	515	9	523
ALJ48957.1	9.13e-173	7	515	9	523

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PXZ_A	9.27e-11	52	196	25	173	ChainA, Major pollen allergen Jun a 1 [Juniperus ashei],1PXZ_B Chain B, Major pollen allergen Jun a 1 [Juniperus ashei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	4.02e-60	40	512	15	415	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	1.10e-59	40	512	15	415	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
A1DPF0	8.21e-59	40	512	15	415	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q0CLG7	4.88e-54	48	512	22	414	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1
B8NQQ7	1.32e-53	48	512	22	414	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000399	0.064859	0.934641	0.000035	0.000039	0.000034

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001391_01372.