CAZyme Information: MGYG000001380_03424

Basic Information

• Species: Ruminococcus_B gnavus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Ruminococcus_B; Ruminococcus_B gnavus
• CAZyme ID: MGYG000001380_03424
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		37641.29	4.9744

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001380	3437962	Isolate	not provided	not provided

• Gene Location: Start: 9737; End: 10789 Strand: +

Full Sequence      

MAEAAAHAVKAAFAALMAGGGMVFVILILIVGIIGGASFIGSSQSSEPLSAEVLAHTQVI
QRYASEFGIPEYVSVIQAIMMQESGGRGTDPMQVSECPYNTQYPNTPGAIQDADYSIKVG
VQYYADCVREAGCKSPQDMDKLKLSLQGYNYGNGYITWAIRKHGGYSEANALQFSQEQAA
AHGWPRYGDPEYVPHVLRYYSGGGLFAGLFGKGPLVTIAKSQLGNEGGQKFWSWYGFDSR
EEWCACFVSWCADQAGLIQKEVVPKFSVCTDGVALFQAKRKWQGGGSVPTPGSLIFFDWN
QDGASDHVGIVESCDGTTVHTIEGNSGDAVKQNSYTVNSQSILGYGLVTY

Enzyme Prediction     

No EC number prediction in MGYG000001380_03424.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13702	Lysozyme_like	8.69e-59	50	200	1	165	Lysozyme-like.
cd16891	CwlT-like	7.94e-53	59	201	4	151	CwlT-like N-terminal lysozyme domain and similar domains. CwlT is a bifunctional cell wall hydrolase containing an N-terminal lysozyme domain and a C-terminal NlpC/P60 endopeptidase domain (gamma-d-D-glutamyl-L-diamino acid endopeptidase), and has been implicated in the spread of transposons. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
pfam05257	CHAP	9.90e-14	244	325	10	83	CHAP domain. This domain corresponds to an amidase function. Many of these proteins are involved in cell wall metabolism of bacteria. This domain is found at the N-terminus of Escherichia coli gss, where it functions as a glutathionylspermidine amidase EC:3.5.1.78. This domain is found to be the catalytic domain of PlyCA. CHAP is the amidase domain of bifunctional Escherichia coli glutathionylspermidine synthetase/amidase, and it catalyzes the hydrolysis of Gsp (glutathionylspermidine) into glutathione and spermidine.
TIGR02594	TIGR02594	0.004	232	345	27	127	TIGR02594 family protein. Members of this protein family known so far are restricted to the bacteria, and for the most to the proteobacteria. The function is unknown.
cd00254	LT-like	0.009	76	200	4	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB22332.1	2.22e-254	1	350	220	569
QEI33001.1	2.22e-254	1	350	220	569
QMW78500.1	3.22e-228	1	350	220	569
QIB53982.1	3.22e-228	1	350	220	569
QYX27925.1	4.74e-223	1	350	220	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4HPE_A	1.58e-17	49	310	20	272	ChainA, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_B Chain B, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_C Chain C, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_D Chain D, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_E Chain E, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630],4HPE_F Chain F, Putative cell wall hydrolase Tn916-like,CTn1-Orf17 [Clostridioides difficile 630]
4FDY_A	4.94e-16	44	199	17	177	ChainA, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50],4FDY_B Chain B, Similar to lipoprotein, NLP/P60 family [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96645	7.54e-30	36	310	37	293	Probable endopeptidase YddH OS=Bacillus subtilis (strain 168) OX=224308 GN=yddH PE=3 SV=1
O34636	5.35e-09	68	178	67	168	Uncharacterized membrane protein YocA OS=Bacillus subtilis (strain 168) OX=224308 GN=yocA PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.984681	0.014073	0.000068	0.000059	0.000042	0.001114

TMHMM  Annotations     

start	end
12	34