CAZyme Information: MGYG000001379_01246

Basic Information

• Species: Schaedlerella glycyrrhizinilytica
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Schaedlerella; Schaedlerella glycyrrhizinilytica
• CAZyme ID: MGYG000001379_01246
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864	MGYG000001379_3|CGC2	95469.11	5.8049

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001379	3227618	Isolate	not provided	not provided

• Gene Location: Start: 90959; End: 93553 Strand: -

Full Sequence      

MRLKVHTKATLSDAMTALEKANREVAYQAALEGIVLLENDGCLPVKPGKIALFGAGAGMT
IKGGTGSGEVNERHAVSIREGLEMSGFTVTTGEWIDEYARLYEAGEKAYAEAFRKKLMTL
NMTNVINLMSEPYQYPFGQPVTKADLEDSGTDTCIYVIARQAGEGADRKLKNKEYTLSEV
ERQNISLCAAYYEKMIVAVNVGAAFDMNFLDEISGINAVVFFAQQGTMGGKAFADLVSGE
ATPSGKLADTWAQHYEDIPFAKEYSYLNGNLNEEHYKEGIYVGYRYFDSFHVTPKYPIGY
GLSYTTFSWDMEEIVVDQTKITVSVRVKNTGEQYAGKEVLQLYVSCPEGRIEKEYQKLAA
FAKTDRLKPGESQIVTLQFDFADLASYSTADARMILEAGEYRFRLGNSSRNTEVCAVVEL
DEEVVTKHLAHICERLSPVEELHQPKREAAEHTGRENTDGEHTGRENTDGEHTGRENSDK
ETNAPENVAHRAICASDFETIEYHYKNPDVYSSEKLDPILNKLSTEELAALTAGAGIRGQ
KKFFEAPGSAGFTTGKLLGKGIPNVALADGPAGLRLQKRSALMRSGKLKAVDPFISLMNY
MPDFVKKLMLADPDKNILLYQFTTAFPVGLALAQSWNTELVEKVGNAVGEEMKAYGVTYW
LAPALNIHRNPLCGRNFEYYSEDPLISGKMAAAMTRGVQKNRGCFVTIKHFCCNNQEDNR
NRTNANVSERALREIYLRGFEIVVKEAYPGAVMSSYNKVNGEYVNNSYDLLTKVLRNEWG
FDGLVMTDWFATGKGLGDHAKAIAAGNDLLMPGGDGAVKAVTKAVQDGVITVTDVRRCAA
NVLHGIMSSRIYYAFCKKNGTLLR

Enzyme Prediction     

EC	3.2.1.21	3.2.1.58	3.2.1.37	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	562	812	6.9e-69	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	7.60e-57	619	825	76	294	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.62e-34	624	843	86	314	Glycosyl hydrolase family 3 N terminal domain.
PRK15098	PRK15098	9.38e-26	23	413	384	758	beta-glucosidase BglX.
pfam01915	Glyco_hydro_3_C	2.95e-24	34	284	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PRK15098	PRK15098	6.80e-21	624	843	118	350	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWY73209.1	0.0	1	857	1	842
AGS54216.1	0.0	5	847	3	818
AUW36666.1	9.91e-275	7	850	6	816
QQQ93533.1	2.59e-216	1	852	1	838
ANU75960.1	2.59e-216	1	852	1	838

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5WUG_A	3.55e-123	24	849	38	822	Expression,characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii],5WVP_A Expression, characterization and crystal structure of a novel beta-glucosidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
2X40_A	1.83e-72	514	849	2	307	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.37e-71	514	849	2	307	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	3.21e-52	561	843	36	283	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.40e-48	513	812	2	252	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P16084	7.27e-117	13	837	20	812	Beta-glucosidase A OS=Butyrivibrio fibrisolvens OX=831 GN=bglA PE=3 SV=1
P15885	3.40e-103	24	860	11	773	Beta-glucosidase OS=Ruminococcus albus OX=1264 PE=3 SV=1
P14002	1.76e-51	561	843	36	283	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	2.94e-49	513	850	2	289	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
P27034	9.16e-49	516	843	2	274	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000060	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001379_01246.