CAZyme Information: MGYG000001377_01640

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01640
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
826	MGYG000001377_3|CGC3	92841.18	6.5145

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 262497; End: 264977 Strand: -

Full Sequence      

MKKGIYIFIFIMASVNIYSQNILTPVSFEQVTLTDNFWNNRMRIQKEVLVPVAFERTEIA
VEDLRRTANYLKGIEGSLPSDSRFSTSDLFKVIEGAAYLLKMERDPKLEKQIDDIADIIA
QAQQPDGYLYPPHITGSYKTAPLWGGAGMGDKPYSWVVHSHELYNMGHLYEAAAAYYQAT
GKKNLLDIATKSARHINKVFFDGDRNYNGGKPVNQAPGHEEIEIALVKLYRVTGDPLYLN
MAKKFIDIRGVTYVPDGKGTMSPEYAQQHAPVREQDKAVGHAVRAVYLYSGMSDVGTLTG
DTTLSPALDKIWGNIVDTRMHITGGLGAIHGIEGFGPEYELPNKEAYNETCAAVGNVFFN
HRMFLLEKDGKYMDVAEVSLLNNVLAGVNLEGNKFFYVNPLASDGTVDRSYWFGTACCPT
NLARLIPQISGLMYAHTDNEIFCSFYTGSKVDFALTSGKVALEQKTNYPFDESIVLTVNP
EKNDQTFSIKMRIPTWVGSQFVPGKLYSYVDNNSKAWELYINDKKVGNLSFKKGEVSLDK
GFVSISRKWKKGDKVELKLPMPVRYSHAINEVKADNDRVAITRGPLVYCAEGVDNSEDVN
RYYLTRVSADAKVQRDDTGILKGIDLIKNVSADYIDVKGNVHQASLNLIPYYAWNNRGVS
TMNIWFAENEKKVRESVAILPVSIKDIKAAYTNEGEHVLSIVNGKHPKNSHDTEINRWTS
WNKKGEKQSVDFTFENPTDIKAFSVYWYDDNGGVRLPDVWNLEYKDDSGSWKPFPLYSTD
SYSLLKDQFNLVHSDGDSFVVESIRLNVTPKVDSAVGILQVRFDIK

Enzyme Prediction     

No EC number prediction in MGYG000001377_01640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	589	4.7e-177	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.01e-145	30	589	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.79e-135	20	670	1	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG1331	YyaL	0.010	180	248	427	499	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIA99612.1	0.0	14	826	23	829
SCD19473.1	0.0	20	824	24	821
QDV74096.1	9.83e-288	26	820	42	832
QDV78726.1	9.83e-288	26	820	42	832
QQE10001.1	1.01e-286	23	821	42	841

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	4.73e-173	23	665	7	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.19e-128	31	668	16	647	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.77e-123	31	668	16	647	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WRE_A	3.34e-100	31	665	3	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	4.42e-100	31	665	3	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	1.83e-99	31	665	3	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000918	0.998151	0.000319	0.000191	0.000187	0.000194

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001377_01640.