CAZyme Information: MGYG000001377_01365

Basic Information

• Species: Dysgonomonas mossii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Dysgonomonadaceae; Dysgonomonas; Dysgonomonas mossii
• CAZyme ID: MGYG000001377_01365
• CAZy Family: GH9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
846	MGYG000001377_2|CGC18	95310.24	6.3336

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001377	3951269	Isolate	not provided	not provided

• Gene Location: Start: 741048; End: 743588 Strand: +

Full Sequence      

MKQHRLVAFFIFCMMVSLSYGQSSWVRINQLGYLPKDIKVAVLISTEEITPDLSFRSRSG
QPPVLPTTQHGIPDFSLIDAKTGKAVYSGQGKIADAAYWGLKSAFRLDFSSVQAEGDYYI
EAAGVKSPQFKIGADIYEGSVDFMLNYMRRQRCGQNNFLGTVCHQHDGFIVEHPTRTGEH
IDVRGGWHDADDKLQYVTTTASAIYHMMLAYYQAKDKTIFKDNYRADASPGSNGIPDILD
EIRWGLDWLSRMNPAPKEMYNQIADDRDHAGYGLPQNDNVDYGWGPGKGRPVYFITGEPQ
DLPNPRNGEIQLNRTTGVASSAGKFASCFALGAELFKNIDPAFAQVLSDKAEPAYEFALE
HPGNTQTVCVVSPYFYEEDNYVDDVELAAATFYTLTKDPKWRTEGDYWGQLEPVNPLWAF
GFARHYQFYPFVNQGHHLMAKSDDEVTSKKFTDFMRQGLQIIRNRAGSEPFMNGVPYVWC
ANFAIIGAASYAHQYKEISGDNSFQEMEAALRDWILGCNPWGFSFIGGFPEGAVSSRTDE
TRLGGLVDGPINEGWHDTFLGVPKVSRSKDPLAAFQNGPAVFHQDSYGTNEPVIDGTCYM
IYYLSIMEQLGRKQSNKPNNTVTDAYGATVRINSDRKVIHLIFSADSAFEGATTILKTLD
KNNAKASFFLTGNCLRMKEHKETIKNIIKKGHYVGGHSDKHLLYASWGNREQSLVTSDSL
INDLRQNIKELEKYGIKKSDVNYYLPPYEWYNKENVSLIESQNQITINFTSGLRTAADYT
TPDMKNYMSSQQIIDQLFAYEKANTLDGAIILIHPGTHPDRKDKLYLRLNEIIKGLVKRG
YSFERL

Enzyme Prediction     

No EC number prediction in MGYG000001377_01365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH9	137	603	5.3e-59	0.9904306220095693

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00759	Glyco_hydro_9	2.67e-50	145	597	7	367	Glycosyl hydrolase family 9.
cd10917	CE4_NodB_like_6s_7s	1.41e-25	637	836	1	170	Catalytic NodB homology domain of rhizobial NodB-like proteins. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes many rhizobial NodB chitooligosaccharide N-deacetylase (EC 3.5.1.-)-like proteins, mainly from bacteria and eukaryotes, such as chitin deacetylases (EC 3.5.1.41), bacterial peptidoglycan N-acetylglucosamine deacetylases (EC 3.5.1.-), and acetylxylan esterases (EC 3.1.1.72), which catalyze the N- or O-deacetylation of substrates such as acetylated chitin, peptidoglycan, and acetylated xylan. All members of this family contain a catalytic NodB homology domain with the same overall topology and a deformed (beta/alpha)8 barrel fold with 6- or 7 strands. Their catalytic activity is dependent on the presence of a divalent cation, preferably cobalt or zinc, and they employ a conserved His-His-Asp zinc-binding triad closely associated with the conserved catalytic base (aspartic acid) and acid (histidine) to carry out acid/base catalysis. Several family members show diversity both in metal ion specificities and in the residues that coordinate the metal.
pfam02927	CelD_N	5.11e-25	24	127	1	83	Cellulase N-terminal ig-like domain.
cd02850	E_set_Cellulase_N	6.25e-23	25	132	1	86	N-terminal Early set domain associated with the catalytic domain of cellulase. E or "early" set domains are associated with the catalytic domain of cellulases at the N-terminal end. Cellulases are O-glycosyl hydrolases (GHs) that hydrolyze beta 1-4 glucosidic bonds in cellulose. They are usually categorized into either exoglucanases, which sequentially release terminal sugar units from the cellulose chain, or endoglucanases, which also attack the chain internally. The N-terminal domain of cellulase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.
cd10948	CE4_BsPdaA_like	4.97e-20	620	846	23	223	Catalytic NodB homology domain of Bacillus subtilis polysaccharide deacetylase PdaA, and its bacterial homologs. The Bacillus subtilis genome contains six polysaccharide deacetylase gene homologs: pdaA, pdaB (previously known as ybaN), yheN, yjeA, yxkH and ylxY. This family is represented by Bacillus subtilis pdaA gene encoding polysaccharide deacetylase BsPdaA, which is a member of the carbohydrate esterase 4 (CE4) superfamily. BsPdaA deacetylates peptidoglycan N-acetylmuramic acid (MurNAc) residues to facilitate the formation of muramic delta-lactam, which is required for recognition of germination lytic enzymes. BsPdaA deficiency leads to the absence of muramic delta-lactam residues in the spore cortex. Like other CE4 esterases, BsPdaA consists of a single catalytic NodB homology domain that appears to adopt a deformed (beta/alpha)8 barrel fold with a putative substrate binding groove harboring the majority of the conserved residues. It utilizes a general acid/base catalytic mechanism involving a tetrahedral transition intermediate, where a water molecule functions as the nucleophile tightly associated to the zinc cofactor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK60909.1	0.0	1	844	1	824
QIK55492.1	0.0	1	845	1	825
AGY53377.1	0.0	1	846	1	831
QIA07887.1	2.53e-292	2	846	3	816
AHW60805.1	1.97e-291	1	846	1	815

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3X17_A	1.74e-31	22	602	14	551	Crystalstructure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium],3X17_B Crystal structure of metagenome-derived glycoside hydrolase family 9 endoglucanase [uncultured bacterium]
5U2O_A	4.56e-25	75	605	20	537	Crystalstructure of Zn-binding triple mutant of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]
4CJ0_A	1.72e-23	16	638	20	568	ChainA, ENDOGLUCANASE D [Acetivibrio thermocellus],4CJ1_A Chain A, ENDOGLUCANASE D [Acetivibrio thermocellus]
1CLC_A	1.81e-23	16	638	34	582	ChainA, ENDOGLUCANASE CELD; EC: 3.2.1.4 [Acetivibrio thermocellus]
5U0H_A	9.61e-22	75	605	20	537	Crystalstructure of GH family 9 endoglucanase J30 [Thermobacillus composti KWC4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0C2S4	9.41e-23	16	638	20	568	Endoglucanase D (Fragment) OS=Acetivibrio thermocellus OX=1515 GN=celD PE=1 SV=1
A3DDN1	9.65e-22	16	638	44	592	Endoglucanase D OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celD PE=1 SV=1
P23658	8.01e-21	74	605	27	543	Cellodextrinase OS=Butyrivibrio fibrisolvens OX=831 GN=ced1 PE=1 SV=1
A7LXT3	1.21e-19	17	610	23	581	Xyloglucan-specific endo-beta-1,4-glucanase BoGH9A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02649 PE=1 SV=1
A3DCH1	2.55e-18	26	610	214	814	Cellulose 1,4-beta-cellobiosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=celK PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000211	0.999200	0.000174	0.000142	0.000134	0.000129

TMHMM  Annotations     

start	end
7	26