CAZyme Information: MGYG000001375_01806

Basic Information

• Species: Ruminococcus_F champanellensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Ruminococcus_F; Ruminococcus_F champanellensis
• CAZyme ID: MGYG000001375_01806
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
957	MGYG000001375_1|CGC25	104948.53	4.6219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001375	2513436	Isolate	not provided	not provided

• Gene Location: Start: 1963530; End: 1966403 Strand: +

Full Sequence      

MSMQQKLKASLSVLLAAAMLTPALAVMPESEPSVYAADTVVVNTGKEYQTIDGFGGMNHP
EWMGSDLTDAQRQKAFGNGEDELGLTILRIFVNPDSNQWNKAVPTAKFAAQHGAKVFASP
WEPPSNLAESDSNGGKLHLPKSNYTAYAQHLNNFGTYMKNQGVDLYAISVQNEPDYASEW
TRWSTDETTDFLANYADKITSTRVMSPESFQYAPETASWVADGGKKYYTKILNNQKAFAN
CDLFGTHFYGTQRAWMDFPALESCGKPIWMTEVYVPNSSSDADTWPEALDVAENIHNGMT
VGNMSAYVWWYIRRSYGPMKENGNISKRGYMMAQYSKFVRPGDVRIDATEQPTQNVFVSA
YKNDADQVTIVAVNKTTSEYNQSFSMGSGESISGVTRYRSSGSENLAKSEISFNGTGFAA
QLPAQSVSTFVVDLGSANTDPDENGWYFHDEFEADTCSWEGRGAAGVMTSGRTNYAGKEA
LLVQDRTAAWNGATKALNAKAFVPGKEYSFSANVSYFDGDLTDTFYLKLQYTDANGDTQY
DSIATAKGVQGKWVQLANTNYTIPAGAKDMQIYVETADTTNNFYIDEAIGAVAGTVIPGA
GAIDVPETLIPGDINLDGVIDGFDLAAAKRGLAAGGFDNVFSAKVADVNKSTVFDAEDVQ
ELSSFLLKKTTAFTDQTPPEPEKKAYTMQEYTDMISKMVVEKEPDASHNEQAGVQYGTVK
SGSYYSTTCKRNKPYNILLPANYSSSKKYPVLYCMHGYWENQDRMIIKGNGTMYTRQIIG
NAIAAGDAEDMIVVFPYIYSSATQDSCSAMDDANNAAYDNFINDLVVDLMPHIESTYSVK
TGRDNTAITGFSMGGRESLLIGMKRSDLFGYVGAICPAPGVTGAFKWNSDEEAPHLLFIT
AGSNDTVVYSNPENYHNNFTKNGVPHIWHYVSGGYHGDNSIHAHMYNFVRAIFKTES

Enzyme Prediction     

No EC number prediction in MGYG000001375_01806.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	39	388	5.4e-135	0.9853801169590644
CE1	726	950	3.2e-38	0.9691629955947136
CBM22	448	576	2.2e-28	0.9618320610687023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5520	XynC	5.51e-123	3	436	1	432	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
COG2382	Fes	8.36e-20	716	934	66	278	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
pfam02018	CBM_4_9	1.54e-16	452	580	9	134	Carbohydrate binding domain. This family includes diverse carbohydrate binding domains.
pfam00756	Esterase	1.29e-14	726	936	1	231	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2819	YbbA	1.32e-11	735	906	25	205	Predicted hydrolase of the alpha/beta superfamily [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL17903.1	0.0	1	957	1	957
ADU21034.1	1.19e-237	36	607	7	581
BAB39494.1	3.22e-237	36	607	36	610
CBL17231.1	1.98e-214	440	954	561	1073
BAB39495.1	2.11e-175	158	607	1	453

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3GTN_A	1.47e-133	37	433	2	390	CrystalStructure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3GTN_B Crystal Structure of XynC from Bacillus subtilis 168 [Bacillus subtilis],3KL0_A Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_B Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_C Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL0_D Crystal structure of the glucuronoxylan xylanohydrolase XynC from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],3KL3_A Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_B Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_C Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL3_D Crystal structure of Ligand bound XynC [Bacillus subtilis subsp. subtilis str. 168],3KL5_A Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_B Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_C Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis],3KL5_D Structure Analysis of a Xylanase From Glycosyl Hydrolase Family Thirty: Carbohydrate Ligand Complexes Reveal this Family of Enzymes Unique Mechanism of Substrate Specificity and Recognition [Bacillus subtilis]
4QAW_A	2.51e-128	42	439	6	395	Structureof modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_B Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_C Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_D Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_E Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_F Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_G Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis],4QAW_H Structure of modular Xyn30D from Paenibacillus barcinonensis [Paenibacillus barcinonensis]
4CKQ_A	8.10e-128	39	431	23	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQ9_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQB_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQC_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQD_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],4UQE_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
4UQA_A	1.60e-127	39	431	23	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus]
5A6L_A	6.24e-127	39	431	23	409	ChainA, Carbohydrate Binding Family 6 [Acetivibrio thermocellus],5A6M_A Chain A, Carbohydrate Binding Family 6 [Acetivibrio thermocellus ATCC 27405]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q45070	2.11e-133	34	433	30	421	Glucuronoxylanase XynC OS=Bacillus subtilis (strain 168) OX=224308 GN=xynC PE=1 SV=1
Q6YK37	3.22e-124	34	432	31	421	Glucuronoxylanase XynC OS=Bacillus subtilis OX=1423 GN=xynC PE=3 SV=2
P51584	1.28e-60	441	911	562	1023	Endo-1,4-beta-xylanase Y OS=Acetivibrio thermocellus OX=1515 GN=xynY PE=1 SV=1
Q53317	1.27e-27	395	621	225	448	Xylanase/beta-glucanase OS=Ruminococcus flavefaciens OX=1265 GN=xynD PE=3 SV=2
P10478	2.19e-26	704	950	36	274	Endo-1,4-beta-xylanase Z OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=xynZ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000318	0.998944	0.000188	0.000208	0.000170	0.000146

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001375_01806.