CAZyme Information: MGYG000001371_02639

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_02639
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YesR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	MGYG000001371_67|CGC5	39079.4	5.2054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 75426; End: 76469 Strand: -

Full Sequence      

MKLKLELTSEDLKQTAERVADYTFGMDLTWDWPGGVAFYGVSRLLDVTGEHAYLKRMIDW
VEEYLEAGLPEGWTVNTCAMGHMLLTLYEQTKDQKYLDIISSKIDYLEHHALRFGDRVLQ
HTVSANNDFPEQCWADTLFMAAYLELRVGVLLEKKALIDDALHQFERHIHYLQDEDSGLW
YHGYNHVTKDHMSGIHWARANAWAAYTMSRAARGLPEGYLYPPMMHIWSSLRDQLAAIKR
LQHDDGLWGTVLDYPEAYGEVSATAGIAAAMVMQGNPLHAKYVRKALDGVLANIADNGRV
LNVSGGTAVMNDIEGYLGIDRKWAQGWGQGLALAFLAAVIEVVESQA

Enzyme Prediction     

No EC number prediction in MGYG000001371_02639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	28	339	1.1e-74	0.9608433734939759

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.03e-87	10	339	14	349	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	7.62e-70	22	340	19	340	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX67065.1	3.15e-257	1	347	1	347
ANY76770.1	4.39e-243	1	345	1	345
QKS48636.1	5.50e-206	3	343	1	340
QGG57461.1	2.40e-205	8	341	6	338
QNK60304.1	1.67e-204	3	346	1	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XUV_A	1.47e-37	30	336	47	365	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
3PMM_A	3.38e-37	30	336	66	374	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	1.25e-36	30	316	65	354	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	2.36e-16	30	291	39	304	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.96e-16	30	291	29	294	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	3.06e-99	4	341	3	337	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	1.29e-15	30	291	39	304	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
L7P9J4	2.59e-07	31	300	59	340	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_02639.