CAZyme Information: MGYG000001371_00774

Basic Information

• Species: Paenibacillus lautus_A
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus; Paenibacillus lautus_A
• CAZyme ID: MGYG000001371_00774
• CAZy Family: CE14
• CAZyme Description: N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235		26205.79	5.1851

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001371	6950059	Isolate	not provided	not provided

• Gene Location: Start: 49716; End: 50423 Strand: -

Full Sequence      

MNTKLDILIFGAHADDAEIGMAGTIAKHTAAGLSVGICDLTQAEMSSNGTVDLRKQEAEQ
AAGILDLKARTNLGLPDRGLFVTPEHIERVTAEIRKFSPSIVFAPYWEDRHPDHVACSRL
VEEAVFNAKLRRYMPEQPPVKVDELYFYFINDIGRTDLVVDVTEQYGVKEQALSCYRSQF
EKAEEDAVSTPLTEGYIERVRARDSLLGARRLIPYAEGFACKSPYVVHLFGPKQA

Enzyme Prediction     

No EC number prediction in MGYG000001371_00774.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE14	8	113	1.5e-23	0.9919354838709677

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04001	thiol_BshB1	1.82e-103	4	227	1	226	bacillithiol biosynthesis deacetylase BshB1. Members of this protein family are BshB1 (YpjG), an enzyme of bacillithiol biosynthesis; either BshB1 or BshB2 (YojG) must be present, and often both are present. Bacillithiol is a low-molecular-weight thiol, an analog of glutathione and mycothiol, and is found largely in the Firmicutes. [Biosynthesis of cofactors, prosthetic groups, and carriers, Glutathione and analogs]
COG2120	LmbE	2.80e-43	1	204	7	213	N-acetylglucosaminyl deacetylase, LmbE family [Carbohydrate transport and metabolism].
pfam02585	PIG-L	3.76e-27	9	121	1	124	GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyzes the second step in GPI biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX64513.1	2.14e-167	1	235	1	235
QOT13102.1	1.24e-166	1	235	1	235
AYB45149.1	5.87e-165	1	235	1	235
AWP28366.1	1.17e-155	1	235	1	235
AVV59196.1	1.37e-154	1	235	1	235

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXD_A	8.53e-84	3	228	2	226	Crystalstructure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus],2IXD_B Crystal structure of the putative deacetylase BC1534 from Bacillus cereus [Bacillus cereus]
6P2T_A	6.93e-66	6	222	25	242	BshBfrom Bacillus subtilis complexed with citrate [Bacillus subtilis subsp. subtilis str. 168],6ULL_A BshB from Bacillus subtilis complexed with a substrate analogue [Bacillus subtilis subsp. subtilis str. 168]
1UAN_A	5.63e-41	5	224	2	218	Crystalstructure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus],1UAN_B Crystal structure of the conserved protein TT1542 from Thermus thermophilus HB8 [Thermus thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q81ST8	4.41e-84	3	228	2	226	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus anthracis OX=1392 GN=bshB1 PE=1 SV=1
Q81FP2	3.59e-83	3	228	2	226	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) OX=226900 GN=bshB1 PE=1 SV=1
P42981	5.07e-66	6	222	5	222	N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB1 PE=1 SV=2
O31857	3.69e-10	4	181	2	188	Probable N-acetyl-alpha-D-glucosaminyl L-malate deacetylase 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=bshB2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000008	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001371_00774.