CAZyme Information: MGYG000001370_03469

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_03469
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
675		76249.29	6.6218

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 53031; End: 55058 Strand: +

Full Sequence      

MKKRTMIVAASLALTLLQSCAKDTYKQDQFVNLLNIETGTTHSPEGYFFADFGCWHGYGF
NNSSDMSEAGGFRGPAFAGERSLGLQWLSPCFEKLTLMEEGNAVPYTKIVSYEYLPGMLR
QYLQAGSLSVEMKQIAVTSRSTMIQYTITNQGAENRSIASVLQGRATYKDAGFSLESGNA
VTVNVAGGKHYFVLSLPDTWTVKNGSEKNMYVASGKSTDLRPGKSYTFHTFTSYCPATGK
QDALAEHASLKVKDAEKYLSRNAERWEGYLSSILDRDTEYLESDRNRKWAVKALMTLHTN
WRSAAGDLKHGGVQPSTGHFNAFWAWDSWEHAVGLSIFNPELAKEQMLTMFDFQTPEGMI
IDLVGLDAKENNEVCSKPPIAGWATYMVYQRSKDKAFAKEMLPKLLKYHEWRYKYRDHDQ
NGLCEYGGIAPQVYQGQWESGMDVAVKFDGVKMLKNAEGAYSFDQESIELNSYLCAEKFY
LAYLLDEVGDKAQAARFREEGKKLKNMIQEKFFDKETGFFYDRKMGTGELVKVIDISGWI
PLFTGVATPEQAAAVKKNMLDPELFGTYFPFSSLNHKHPLYQPDKGYFRGQTWMNYTYFG
IRGWKNYGFMEDAAKYTNLLPDRLKGLTEPGYPIRENWNSATGEAMTAKHFGWSSAFSIL
LLAEDTDTFPYVPGM

Enzyme Prediction     

No EC number prediction in MGYG000001370_03469.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	202	663	1.1e-89	0.5649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.10e-124	1	656	1	774	alpha-glucosidase; Provisional
COG3408	GDB1	6.55e-18	315	665	277	606	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.17e-10	318	566	123	403	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
PLN02567	PLN02567	3.04e-07	287	556	106	429	alpha,alpha-trehalase
pfam03200	Glyco_hydro_63	1.12e-05	559	664	375	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QZE15223.1	1.20e-142	53	665	2	603
AFD06330.1	7.35e-142	27	664	25	651
QEC45275.1	1.95e-138	26	662	21	647
BAX79308.1	2.31e-138	17	667	18	678
AJW62235.1	7.28e-138	27	664	23	648

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	1.11e-71	28	661	3	752	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	5.61e-71	28	661	3	752	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	7.76e-71	28	661	3	752	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	3.52e-67	28	656	4	748	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
6XUX_A	1.92e-30	416	661	13	301	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.26e-71	1	661	1	775	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8T3S4	1.04e-15	311	662	85	485	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
D8QTR2	1.38e-15	311	662	85	485	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
P94250	1.36e-10	366	665	103	390	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000063	0.042574	0.957348	0.000015	0.000020	0.000016

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_03469.