CAZyme Information: MGYG000001370_02697

Basic Information

• Species: Bacteroides fluxus
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fluxus
• CAZyme ID: MGYG000001370_02697
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		42352.37	5.9005

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001370	4330086	Isolate	not provided	not provided

• Gene Location: Start: 60428; End: 61558 Strand: +

Full Sequence      

MIKTAFIGLGYRGKQLLKLLQCLPAFRIVAFADPGVEDSGIPGVLCYNRSEDDYLDMLDR
HAPDLVFVASPWQYHVQHALQCVERGCHVALEIKGGLYVDEYLPLMESADRHGCRVFPLE
NTLFMRENLAVSNIVNAGLLGEIVYMRGGYRHDLRHLLLDDAGNIGNREKTESVWRGRFY
QEENGDLYPTHGLAPLCMIAGINRKDRVKCLTSFASKPAGILQRIRDLGGNTDVKIRTGD
VVVTQLETEKGILITLTHDTTLPRPRSLDFEVQGTKGIWQGDRRLIYIEGSSPDETWEAD
AAYIDRYEHIYWHRWGKEALVADTHHQGMDYIMLKALEADLKDEIPYPATLGDLALWTSV
TPRSIQSIAEGKTVGL

Enzyme Prediction     

No EC number prediction in MGYG000001370_02697.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	2	372	2e-107	0.9448621553884712

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	4.74e-17	1	376	3	340	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	5.97e-11	2	117	1	117	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
pfam03447	NAD_binding_3	0.001	56	117	52	114	Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV42950.1	6.72e-239	1	376	9	384
QUT33801.1	2.33e-233	2	376	4	378
QQA30653.1	2.33e-233	2	376	4	378
QUT62197.1	2.33e-233	2	376	4	378
QRO24037.1	1.43e-159	2	376	4	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	4.37e-77	2	374	21	420	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	1.74e-39	2	371	43	424	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3MOI_A	1.33e-06	2	113	3	115	Thecrystal structure of the putative dehydrogenase from Bordetella bronchiseptica RB50 [Bordetella bronchiseptica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	2.39e-76	2	374	21	420	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	4.58e-72	2	370	34	426	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A6LB54	4.36e-64	2	371	50	443	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A4Q8G1	6.42e-64	1	374	52	448	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A4FN60	3.51e-60	2	368	61	429	Glycosyl hydrolase family 109 protein OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) OX=405948 GN=SACE_6314 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001370_02697.