CAZyme Information: MGYG000001369_01572

Basic Information

• Species: Lactobacillus delbrueckii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lactobacillus; Lactobacillus delbrueckii
• CAZyme ID: MGYG000001369_01572
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
228	MGYG000001369_1|CGC22	24746.6	10.0685

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001369	1875811	Isolate	not provided	not provided

• Gene Location: Start: 1674778; End: 1675464 Strand: +

Full Sequence      

MGQKKHFQHPATLPALLILLAAIISLLAYGLYNYASQTTLPKGASQSAVGLKVSQADFDL
SRLEKGGLSFVYLPVGQNFAARREQVAKTKLAYGSIIEVQGEKNAEKQLSRAKRLAAGHW
GALPILLDSGQDDPSAANLTAMSKLAYSLVKSHEIMVNAPVKYKKLFPAGCKFLATSASA
PSKLDYCFWRYTEKGNVAGVSGIGYKNVMYAYIGTSQQYKEKYGQLAQ

Enzyme Prediction     

No EC number prediction in MGYG000001369_01572.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06419	GH25_muramidase_2	2.50e-08	41	197	1	176	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASW11623.1	3.69e-160	1	228	1	228
APG69721.1	4.30e-159	1	228	1	228
AZA16572.1	1.23e-158	1	228	1	228
QTG34576.1	1.23e-158	1	228	1	228
ADQ60532.1	2.91e-157	1	228	1	228

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999623	0.000223	0.000010	0.000001	0.000001	0.000180

TMHMM  Annotations     

start	end
10	32