CAZyme Information: MGYG000001365_00757

Basic Information

• Species: Phascolarctobacterium_A succinatutens
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Acidaminococcales; Acidaminococcaceae; Phascolarctobacterium_A; Phascolarctobacterium_A succinatutens
• CAZyme ID: MGYG000001365_00757
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
529	MGYG000001365_31|CGC1	60242.78	9.2683

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001365	2121560	Isolate	not provided	not provided

• Gene Location: Start: 13469; End: 15058 Strand: -

Full Sequence      

MPRKYWLLLFAAAAALLFAGNGSLLITDSVESNYALTAKEMVLSGDWLSPQIYGHYWYDK
PIFFYWMTALAYKMFGFTEFASRFFPALFGLGSVALLAWGGSKLENARSGFISALVLLSS
VEFFLISKSVITDAVLFFFFSATLLFFYLGYRDGRARYWYIMYAAAGFAVLTKGPIGVLL
SGLIITLFLLWQRDWHVLKRMHLVSGTLLCAAVVVPWYAVMYSLHGSDFINTFFGTHNFL
RATVSEHPRDDVIYYYTLVNLLALFPWSGLVPRAAYKWWRQGHRSLEEQQKFLLLWALVV
FIFFQCMATKYITYTYPLLFPASLLLGSMLAKHTDCVDGGYMIFVGGGFGLLLVGAWFAV
SHQLIASELLFLLPLALIIGVMLDYILRLVTGERVCSIAAMSAVFYIALIFSLAIPFSEQ
RSAKNLGEMLTENDVHEVGLYGKYHTSAVFYSSSKIVKLMHEREVAGYVPKDFSWTSKNV
MPYATLERNPYRFVVVTTKSYDRFIAQQNKKWQVIDADNSWIMLRMKHI

Enzyme Prediction     

No EC number prediction in MGYG000001365_00757.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	512	1.4e-111	0.9777777777777777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	7.50e-55	20	327	24	333	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	9.31e-33	31	342	33	342	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	9.35e-22	59	217	1	157	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.77e-12	31	218	32	231	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4745	COG4745	8.56e-04	54	173	56	177	Predicted membrane-bound mannosyltransferase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTV78033.1	0.0	1	527	1	527
AEQ23377.1	9.11e-134	1	528	1	544
ADB46704.1	1.08e-126	1	500	1	515
AJQ28749.1	4.80e-117	2	507	14	528
AVO74995.1	3.03e-114	8	523	30	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.80e-34	6	367	33	395	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4SQX1	1.12e-30	31	328	30	328	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas salmonicida (strain A449) OX=382245 GN=arnT PE=3 SV=1
A0KGY4	6.83e-30	31	368	30	375	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / BCRC 13018 / CCUG 14551 / JCM 1027 / KCTC 2358 / NCIMB 9240 / NCTC 8049) OX=380703 GN=arnT PE=3 SV=1
A1JPM4	7.98e-29	11	342	9	343	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=arnT PE=3 SV=1
A8GDR9	1.18e-27	6	337	8	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Serratia proteamaculans (strain 568) OX=399741 GN=arnT PE=3 SV=1
Q3KCC9	1.37e-26	31	342	50	362	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 1 OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=arnT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999088	0.000881	0.000037	0.000002	0.000002	0.000007

TMHMM  Annotations     

start	end
5	27
80	102
109	126
130	149
156	170
174	191
203	225
252	271
292	314
339	361
368	390
395	417