CAZyme Information: MGYG000001357_00393

Basic Information

• Species: Helicobacter pylori_C
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter; Helicobacter pylori_C
• CAZyme ID: MGYG000001357_00393
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372		43995.43	8.6692

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001357	1566655	Isolate	not provided	not provided

• Gene Location: Start: 389585; End: 390703 Strand: -

Full Sequence      

MSITIPIVIAFDNHYAIPAGVSLYSMLACAKLENPQSQNDSEKLFYKIHCLVDNLSLENQ
RKLKETLAPFSAFMSVDFLDISTPNLYTTPIEPSVIDKINEAFLQLNIYAKTRFSKMVMC
RLFLASLFMQYDKIIMFDADTLFLNDVSESFFIPLDGYYFGAAKDFSSPKSPKHFQTERE
RAPRQAFFLYEHYLKEKDIKILYENHYNVGFLIVNLKLWRTDRLEECLLNLARQKGQCVF
CPEQDLLTLACYQKVLILPYIYNTHPFMVNQKRFIPNRQEIVMLHFYFVGKPWVSPTALY
SKEWHEILLKTPFYAEYSVKFLKQMTEFLSLKDKQKTFEFLAPLLNPKTLLEYVFFRLNR
IFKRLKEKFFNS

Enzyme Prediction     

No EC number prediction in MGYG000001357_00393.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	5	295	1.2e-60	0.8754863813229572

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1442	RfaJ	1.07e-96	4	369	2	325	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	1.87e-56	5	293	1	246	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	1.34e-29	6	293	1	248	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
cd00505	Glyco_transf_8	5.64e-09	121	294	86	245	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
cd02537	GT8_Glycogenin	3.59e-06	130	307	89	236	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADU40543.1	3.12e-272	1	372	1	372
BAJ59253.1	2.35e-267	1	372	1	372
BAW43501.1	2.63e-264	1	372	1	372
BAW71414.1	3.74e-264	1	372	1	372
BAW69902.1	5.31e-264	1	372	1	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6U4B_A	2.03e-12	5	316	302	591	ChainA, WbbM protein [Klebsiella pneumoniae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000030	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001357_00393.