CAZyme Information: MGYG000001355_01889

Basic Information

• Species: Anaerococcus hydrogenalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Tissierellales; Peptoniphilaceae; Anaerococcus; Anaerococcus hydrogenalis
• CAZyme ID: MGYG000001355_01889
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
218	MGYG000001355_50|CGC1	25233.12	8.1392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001355	1889362	Isolate	not provided	not provided

• Gene Location: Start: 95179; End: 95835 Strand: -

Full Sequence      

MKALKSIFKIIGLIIISIVMAIIISFSIVAYQTSRQKIAYQDEIKKYSEKYNMDPLLIAS
IIKVESDYDNEAHSNQNAKGLMQLLDTSAKHSAELIGEEYYPDKLKDVDYNLNLGVGYFN
YLYKYYNDVDLALAAYNGGIGNVDKWIQEKKIDKHDPDPTKIPVEETRQYVIKINSNYDL
MKVFYDNGLPSEKELKNRKDLSIKNYKKFVKKILFDVL

Enzyme Prediction     

No EC number prediction in MGYG000001355_01889.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	181	1.8e-25	0.8296296296296296

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.75e-54	38	180	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.87e-37	39	178	5	146	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.81e-31	55	178	1	110	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	3.82e-26	25	191	124	293	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	3.38e-23	44	151	1	107	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQN55587.1	6.12e-129	1	218	1	218
QQB62557.1	1.44e-127	1	218	1	218
ACV29351.1	1.48e-92	1	217	1	217
QQK07141.1	2.29e-48	1	185	1	182
BAG07763.1	1.36e-41	18	214	15	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.52e-11	40	177	416	551	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.53e-11	40	177	420	555	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.54e-11	40	177	426	561	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.55e-11	40	177	430	565	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	3.56e-11	40	177	436	571	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31976	3.50e-12	40	178	1422	1541	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	3.50e-12	40	178	1422	1541	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31608	6.15e-12	44	178	64	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
A8GJ50	1.25e-09	40	176	191	350	Membrane-bound lytic murein transglycosylase C OS=Serratia proteamaculans (strain 568) OX=399741 GN=mltC PE=3 SV=1
Q7N7I2	2.29e-09	40	176	191	350	Membrane-bound lytic murein transglycosylase C OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.887289	0.035208	0.003376	0.000324	0.000169	0.073667

TMHMM  Annotations     

start	end
7	29