CAZyme Information: MGYG000001351_02642

Basic Information

• Species: Edwardsiella tarda
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Edwardsiella; Edwardsiella tarda
• CAZyme ID: MGYG000001351_02642
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000001351_83|CGC23	22428.48	9.5689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001351	3631674	Isolate	not provided	not provided

• Gene Location: Start: 2199154; End: 2199765 Strand: +

Full Sequence      

MTHTTQRIYVIGIGLLLLMVAGCSSRHHRPAASYNPNAYDGLIQTAATQYHLDPKLIKAI
IQVESSYNPNAVSPSNAIGLMQLKADGAGCDAYRYQGKRGCPDSDDLFDPATNIRLGAAY
LGALQNQQLYWINDPLTRRYATEVAYANGAGALLRTFSANRQTAIAMINRLSPAAFHWHV
RQHHPAAQAPRYMQKVETAYRNL

Enzyme Prediction     

No EC number prediction in MGYG000001351_02642.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	202	3e-22	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.23e-80	43	201	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	5.46e-63	15	199	8	199	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	1.75e-55	39	202	192	355	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	3.73e-28	43	166	1	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd16896	LT_Slt70-like	1.85e-26	39	127	4	90	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATI64939.1	8.52e-149	1	203	1	203
AKH88342.1	8.52e-149	1	203	1	203
QPR27928.1	3.31e-137	1	203	1	203
AOV96191.1	1.91e-136	1	203	1	203
AGH74674.1	5.88e-131	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	1.48e-47	44	199	27	182	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	1.93e-47	44	199	44	199	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	4.20e-47	44	199	27	182	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	4.20e-47	44	199	27	182	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	4.20e-47	44	199	27	182	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1XAN4	1.78e-50	16	199	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / DH10B) OX=316385 GN=emtA PE=3 SV=1
Q3Z2V5	1.78e-50	16	199	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Shigella sonnei (strain Ss046) OX=300269 GN=emtA PE=3 SV=2
P0C960	1.78e-50	16	199	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=emtA PE=1 SV=1
C4ZTN4	1.78e-50	16	199	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12 / MC4100 / BW2952) OX=595496 GN=emtA PE=3 SV=1
B1IU99	1.78e-50	16	199	9	199	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / NBRC 3972 / NCIMB 8545 / WDCM 00012 / Crooks) OX=481805 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000076	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24