CAZyme Information: MGYG000001347_01634

Basic Information

• Species: Fusobacterium vincentii
• Lineage: Bacteria; Fusobacteriota; Fusobacteriia; Fusobacteriales; Fusobacteriaceae; Fusobacterium; Fusobacterium vincentii
• CAZyme ID: MGYG000001347_01634
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
202		22871.02	4.5581

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001347	2268272	Isolate	not provided	not provided

• Gene Location: Start: 1682893; End: 1683501 Strand: -

Full Sequence      

MKKNLLVVIFIFSSILCLAKERNSEVESKVYQFINSQPVNSEDIEDIYNAIIKSSKEFDV
DPQLIATIIKHESAYDQFAKSPAGAIGFMQLMPETADNMGVDDIYDIYDNIRGGVKYFKQ
CLIKTKNDIPLALAAYNAGIGNVSKYNGIPPFKETQNYVDKILDTYNKKFGKKVRYNEVE
FEKAVDGIFSEITFENAEEGEI

Enzyme Prediction     

No EC number prediction in MGYG000001347_01634.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	56	175	7.3e-33	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.75e-49	62	167	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16896	LT_Slt70-like	5.84e-39	51	168	8	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	5.20e-38	50	163	9	143	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd13403	MLTF-like	2.40e-35	51	167	1	157	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.43e-29	51	158	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EEU32859.1	3.32e-141	1	202	1	202
ALM94289.1	2.16e-137	1	202	1	202
ASG30830.1	8.78e-137	1	202	1	202
ALF17355.1	3.94e-124	1	202	1	202
EFG34987.1	2.45e-46	1	196	1	188

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	2.51e-11	49	163	418	549	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	2.52e-11	49	163	422	553	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	2.53e-11	49	163	428	559	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	2.53e-11	49	163	432	563	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	2.54e-11	49	163	438	569	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	3.00e-35	47	166	60	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	3.19e-34	48	168	1422	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	3.19e-34	48	168	1422	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	7.78e-13	48	171	8	124	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q9KTN5	9.91e-11	53	176	307	439	Membrane-bound lytic murein transglycosylase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000378	0.997974	0.001112	0.000179	0.000182	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001347_01634.