CAZyme Information: MGYG000001339_01277

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_01277
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000001339_1|CGC9	41079.41	9.7972

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 1285726; End: 1286829 Strand: +

Full Sequence      

MSLFLSCGEASGDHYAGRLIEAVKSKVAPVWGMFGPEGTMAGGHALWGLEELQVMGISEA
FKEIPRLMRLKNAMVDRVLSEMPSCVVVIDSPDYHIPLIKALRKRGYAKPVFYVSPPTAW
AWRRGRASALRDLKVICLPLFEMEHLFYKQRGVESHWTGHPLLDDLSGYVPEERVLKNTD
ASPIAALLPGSRSSETRRLAPVLKDAGLMLQETGYHPVISIAKNLSARDREMIKSICHPL
TFFEGKGVDLIFQSQLVVGACGTAAVEAMMFDKFMVVLYKASLLSYIVFKVMVKTKWVSM
PNVLLRREVYPELLQGKANVGAIKRAICMYLENSAKIHKDLLEAKNKMGRRGAYRLWADV
ILERVGR

Enzyme Prediction     

No EC number prediction in MGYG000001339_01277.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	341	2.7e-83	0.96045197740113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0763	LpxB	3.01e-79	1	363	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	1.26e-74	1	363	2	373	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	9.64e-73	3	356	1	366	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	3.04e-37	2	317	228	554	lipid-A-disaccharide synthase; Reviewed
PRK14089	PRK14089	3.99e-35	1	320	2	306	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM20975.1	5.88e-173	1	367	1	367
ADE57615.1	5.67e-109	1	363	1	361
AER66289.1	8.54e-105	1	367	1	372
QVL35430.1	5.10e-90	1	363	1	368
QTX31623.1	1.44e-89	1	363	1	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	2.79e-36	1	338	7	352	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.79e-36	1	338	7	352	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B1JBP7	2.86e-50	5	362	8	369	Lipid-A-disaccharide synthase OS=Pseudomonas putida (strain W619) OX=390235 GN=lpxB PE=3 SV=1
Q0VQE4	4.85e-50	5	327	12	341	Lipid-A-disaccharide synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) OX=393595 GN=lpxB PE=3 SV=1
Q1D393	1.42e-48	3	363	7	376	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q1R020	1.61e-47	1	345	1	351	Lipid-A-disaccharide synthase OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=lpxB PE=3 SV=1
C1DST3	1.06e-46	5	363	9	375	Lipid-A-disaccharide synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) OX=322710 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001339_01277.