CAZyme Information: MGYG000001339_00748

Basic Information

• Species: Acetomicrobium hydrogeniformans
• Lineage: Bacteria; Synergistota; Synergistia; Synergistales; Acetomicrobiaceae; Acetomicrobium; Acetomicrobium hydrogeniformans
• CAZyme ID: MGYG000001339_00748
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495	MGYG000001339_1|CGC6	55557.82	10.1798

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001339	2123925	Isolate	not provided	North America

• Gene Location: Start: 766049; End: 767536 Strand: +

Full Sequence      

MSTQSKTSSRRQFLFVILLALLASIAFQGSRGLYETTEGRYAEVAREMLRSGNYLEPTLL
GLPHWSKPPLTYWAIALGLKIFGLNAWGARFYLVISFVLTVICVWKIAQTLWDKKSAYLS
AVVYTSSLMPLVSSNVVSTDTLLALWEALAIFAFWKAVRTQSKRWTVLVWLFLGMSFMTK
GYPGLLPLLGIIPTQIYLRKARGAQVPRLLTASGMLTFIALGLGWYIFEAIKHPYLVPYW
LGHEVVGRFSEESEFHNPHFYQAFEIYIPTLIFGTLPWSALLTCKFKATKDIVKSALSKN
ALFKNPQNLFLFSYTLLSLVLFFMAKSKLQLYILPLFLPLSLIMGRALAAFLDLNVIKKG
SIIRILTISSCIFIVALKALSGTSVVSSPHDMKRLSASIDEAVAARSFQLLVVYDKKLNG
LVFYKDEILDHINPGMSDQLSEKVIAAFRNGKTPVVLLRADNVDLVSDALRRSGIPITVK
DLYGGWMLITCEQRS

Enzyme Prediction     

No EC number prediction in MGYG000001339_00748.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	6	380	3.1e-82	0.6592592592592592

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	3.10e-51	6	389	1	375	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	1.56e-43	9	397	6	388	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	3.18e-16	66	192	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	2.39e-07	34	191	28	192	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
pfam16032	DUF4788	0.002	369	452	33	111	Domain of unknown function (DUF4788). This presumed domain is functionally uncharacterized. This domain family is found in eukaryotes, and is approximately 230 amino acids in length. There is a single completely conserved residue D that may be functionally important.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFM22472.1	0.0	1	495	1	495
AKU91982.1	1.59e-65	1	495	1	486
BCT92498.1	1.01e-63	16	421	6	398
BCT95651.1	1.01e-63	16	421	6	398
AMD93208.1	1.59e-56	19	424	65	465

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	2.18e-16	17	348	38	364	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2VBI7	6.64e-34	9	345	4	329	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
Q02R27	1.18e-33	9	355	2	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) OX=208963 GN=arnT PE=3 SV=1
B7VBN0	2.20e-33	9	355	2	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=arnT PE=3 SV=1
Q4K884	5.47e-33	30	348	57	364	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase 2 OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=arnT2 PE=3 SV=1
Q9HY61	5.55e-33	9	355	2	338	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.451062	0.155160	0.032570	0.242838	0.106783	0.011587

TMHMM  Annotations     

start	end
13	30
86	105
117	139
167	189
209	231
260	282
308	325
330	352
365	387