CAZyme Information: MGYG000001337_04241

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_04241
• CAZy Family: GT10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
296	MGYG000001337_5|CGC1	34677.59	4.6495

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 91070; End: 91960 Strand: -

Full Sequence      

MDILILFYNTMWGFPLEFRKEDLPGGCVITTDRNLIAKADAVVFHLPDLPSVMEDEIDKR
EGQLWVGWSLECEENYSWTKDPEFRESFDLWMGYHQEDDIVYPYYGSDYGKMLVTARREK
PYKKKACMFISSDMNRSHRQEYLKELMQYTDIDSYGKLYRNCELPVEDRGRDTLLSVIGD
YQFVISFENAIGKDYVTEKFFNPLLAGTVPVYLGAPNIREFAPGENCFLDICTFDSPEGV
AAFMNQCYDDEALYERFYAWRKRPLLLSFTKKLEQVRSNPLIRLCQKIHELKLGGI

Enzyme Prediction     

No EC number prediction in MGYG000001337_04241.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	3	292	2.1e-77	0.8559077809798271

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00852	Glyco_transf_10	1.14e-35	123	290	2	161	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
pfam17039	Glyco_tran_10_N	1.66e-16	4	104	5	108	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ39295.1	9.40e-231	1	296	1	296
ANQ61950.1	5.44e-230	1	296	1	296
BAD50785.1	5.44e-230	1	296	1	296
QRP88399.1	1.10e-229	1	296	1	296
AKA53441.1	1.10e-229	1	296	1	296

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O88819	2.74e-27	11	262	70	320	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Mus musculus OX=10090 GN=Fut9 PE=1 SV=1
Q11131	3.03e-27	11	263	98	351	Alpha-(1,3)-fucosyltransferase 7 OS=Mus musculus OX=10090 GN=Fut7 PE=1 SV=1
Q99JB3	3.80e-27	11	262	70	320	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Rattus norvegicus OX=10116 GN=Fut9 PE=1 SV=1
G3MZR2	5.60e-27	11	296	51	332	Alpha-(1,3)-fucosyltransferase 7 OS=Bos taurus OX=9913 GN=FUT7 PE=1 SV=2
Q9Y231	7.29e-27	11	262	70	320	4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase 9 OS=Homo sapiens OX=9606 GN=FUT9 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_04241.