CAZyme Information: MGYG000001337_03785

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_03785
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
517	MGYG000001337_3|CGC11	59123.59	9.5952

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 646408; End: 647961 Strand: -

Full Sequence      

MKSKFLPFLLLLAVLPVLIFRDYTPSNELRYLSIVDEALRNGDIFTFTNHGIQYADKPPL
YFWILMLGKWLLGNHAMWFASLFSFIPALVIMLVMDRWVEREVSVANRLSAQLMLMSCGL
FLGLAVVLRMDMLMCMFIVLALRTFYQMLKGQGSKNWNQFLFPFYIFMAVFSKGPVGILV
PLVSTFIFLLITGRVKTFGRYWGWKTFAVLLLGCFIWFGGVCWEEGGLTYLHDLLFRQTV
GRAVNAFDHSAPFYYYFISVWYSLAPWALFLVGIIIAGACRRLIRSDMERFFMVIILTTL
LMLSCFSGKLAVYLAPTFPFFVYLAVLLLSHFRWNQWLALTLLLPAVVFVAGLPALIVLG
RMPGTEFLGQKLFYVAGGILTVSGGTALYFLYRKKSLNKTINVLALGLFCAVFVGGWDVP
AINGELGYSELCRKAVELSKEKNVSGYCVLNVRRSENMDVYLHERVKEVTEEEVLDNKYQ
NTILMISNKKIRSNKKLEEFVNGKEHYVIGRFSVMVL

Enzyme Prediction     

No EC number prediction in MGYG000001337_03785.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	7	442	3.3e-69	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	8.85e-22	20	431	27	443	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
PRK13279	arnT	1.20e-13	28	360	33	367	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam13231	PMT_2	2.40e-05	56	212	1	152	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU03965.1	0.0	1	517	1	517
QRP88934.1	0.0	1	517	1	517
QLK84536.1	0.0	1	517	1	517
QKH86812.1	0.0	1	517	1	517
QTO25703.1	0.0	1	517	1	517

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B7UFR9	8.75e-09	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) OX=574521 GN=arnT PE=3 SV=1
B7LM74	2.67e-08	27	318	31	321	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=arnT PE=3 SV=2
C5BDQ8	3.54e-08	27	318	31	321	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
B4TBG8	1.07e-07	5	282	11	287	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
Q8FFL9	1.08e-07	27	318	31	320	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.481668	0.515321	0.001166	0.000511	0.000505	0.000807

TMHMM  Annotations     

start	end
5	24
77	99
120	142
166	188
201	223
257	279
291	308
312	330
337	359
374	393
400	422