CAZyme Information: MGYG000001337_03448

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_03448
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		63612.39	8.5925

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 211741; End: 213444 Strand: -

Full Sequence      

MKRLSTLCLLAAGFFIPGQAHQARPTVLDSVYAPLKVATPPSDAYIGLSLLDNGEIRHYN
YGEQAVAGTVYLSSTDHGLTWKRVNRPKEMPFADCQSPVSKEYIRLVDMGAMGVYCIRTS
GGLTGGRTLTKVADRNSIMIKPPVFIRNGKRIVVAAHGGVTPKGCYTYFSDDDGLTWKCS
NTVTSPDHQGGGFHKGIRWNHGAVEPTVVELKDGTLWMLMRTSQDFHYQAFSKDGGQTWG
ESEPSPFYGTITMPTLGRLANGRLLLFWCNTTPLPEKEGTDGVWDDVFTNRDVTHVAVSD
DDGKTWKGFRELYMDPMRNDIDYAVHGGGIDRGVHQAQFVEVAPGKVLASIGQHPLHRAM
MMFDVNWLYEKSRFNDFTDSLSQWSTFNYMNGIKGHCAYNRIQGCMLEPHPRKEGRQVLH
LTYRPDASLVADTRGAVWNFPAMKKGTFTVSLRIPEGSHSVSLLLNDRWMNPSDTVARYQ
SMYELPLTRKQLGVKDDRWHEVSLEWDLLQKRPQARVRVDGRLRPLRLPLKNKSQNGISY
VHFIAPPAEANPGVYLEWVRAEADGAI

Enzyme Prediction     

No EC number prediction in MGYG000001337_03448.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	64	312	5.3e-25	0.5467836257309941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	8.03e-26	146	316	153	303	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.08e-16	142	307	115	252	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
cd15482	Sialidase_non-viral	5.44e-09	170	351	52	216	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
cd15482	Sialidase_non-viral	9.53e-05	206	334	17	151	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
COG4409	NanH	1.43e-04	147	327	530	681	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA19389.1	0.0	1	567	1	567
BAD49844.1	0.0	1	567	1	567
QRP89240.1	0.0	1	567	1	567
ANQ61181.1	0.0	1	567	1	567
QCQ42527.1	0.0	1	567	1	567

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000346	0.998850	0.000282	0.000189	0.000172	0.000149

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_03448.