CAZyme Information: MGYG000001337_01347

Basic Information

• Species: Bacteroides fragilis
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis
• CAZyme ID: MGYG000001337_01347
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371		43160.66	6.7275

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001337	5115082	Isolate	not provided	not provided

• Gene Location: Start: 1027896; End: 1029011 Strand: +

Full Sequence      

MKRIGIYIVIVVCILSCISSRRNLLTETRLMLVDTRATEHTAALFYNLRQLTGKRVVYGQ
HNYEMDGFDSDSTRWRDEANRCDAYDVTGAYPALASFDFLHFTNPRSWETKELNYIQEKF
HVAYNRGNVITFCWHYYNPVTGGNFYDTTQVVRHILPGGSYHATFKADLKIIADFAHNAK
GDDGELIPIIFRPWHEFDGNWFWWGKNHCSVEEFKKLYRFTVTYLRDSLEVHNFLYAFSP
DCGFTTEAEYLERYPGDKYVDVVGMDNYWDFRPDGGDTSLVVLKARILTQYAQKHGKLSA
ITETGTQTRDSLWYTQLLSILRSEGVALNYVCTWSGFSPYKGHPAAADFCRFKRDTLVLF
ADEIPNFYTWH

Enzyme Prediction     

No EC number prediction in MGYG000001337_01347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	33	338	5.3e-71	0.9141914191419142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	1.15e-35	33	298	1	263	Glycosyl hydrolase family 26.
COG4124	ManB2	2.82e-16	158	311	157	302	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CUA17418.1	1.20e-289	1	371	1	371
AKA50870.1	1.20e-289	1	371	1	371
BAD47590.1	1.20e-289	1	371	1	371
QCQ40508.1	1.70e-289	1	371	1	371
ANQ59508.1	4.89e-289	1	371	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Q78_A	1.05e-79	27	368	52	412	Thestructure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q78_B The structure of GH26C from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
2VX4_A	4.43e-79	32	368	33	395	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	4.43e-79	32	368	33	395	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	8.50e-79	32	368	56	418	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	3.50e-78	32	368	33	395	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1A278	3.22e-57	34	363	44	397	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
P49424	8.09e-53	32	324	49	348	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
P49425	1.63e-17	32	366	146	459	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
O05512	1.25e-14	87	335	82	325	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	5.49e-14	70	334	65	322	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.005265	0.346083	0.647467	0.000311	0.000426	0.000440

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001337_01347.