CAZyme Information: MGYG000001333.1_02873

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_02873
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34673.91	10.0448

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 1411304; End: 1412242 Strand: -

Full Sequence      

MIKRKIAYCLATLGVSIGIIGAATTNSKAASSAIPDVSEWQGKMTSLQAQNLKNQVSFVI
NRRQYGSSYVDKYATNNTALYVKYGIPFGEYDYAMFTSPASAKTEAKNFYNRSNKSAKFY
VLDYEQNNVTSGSSKAAVLAWYNEMRSLTNKKLVFYSYQSFATQYAGSARNNFDAQWIAN
YSAKPTIATDLWQYTNKYYLAALGKYVDNSKVVTHPASWWTGTSIASTALADTSAVTTPK
YYHALNAAKQVTVNKKIYLYDSKTFSKANRVKTLSAGDSVSIQSVTKRSTGSYYFTTTTG
QYITANRSYVNE

Enzyme Prediction     

No EC number prediction in MGYG000001333.1_02873.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	36	201	2.4e-32	0.9774011299435028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06523	GH25_PlyB-like	1.20e-59	33	212	1	177	PlyB is a bacteriophage endolysin that displays potent lytic activity toward Bacillus anthracis. PlyB has an N-terminal glycosyl hydrolase family 25 (GH25) catalytic domain and a C-terminal bacterial SH3-like domain, SH3b. Both domains are required for effective catalytic activity. Endolysins are produced by bacteriophages at the end of their life cycle and participate in lysing the bacterial cell in order to release the newly formed progeny. Endolysins (also referred to as endo-N-acetylmuramidases or peptidoglycan hydrolases) degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd00599	GH25_muramidase	1.83e-23	34	208	2	182	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	5.62e-18	36	201	2	178	Glycosyl hydrolases family 25.
cd06524	GH25_YegX-like	2.82e-16	36	213	4	187	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06522	GH25_AtlA-like	1.80e-14	36	210	5	189	AtlA is an autolysin found in Gram-positive lactic acid bacteria that degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family includes the AtlA and Aml autolysins from Streptococcus mutans which have a C-terminal glycosyl hydrolase family 25 (GH25) catalytic domain as well as six tandem N-terminal repeats of the GBS (group B Streptococcus) Bsp-like peptidoglycan-binding domain. Other members of this family have one or more C-terminal peptidoglycan-binding domain(s) (SH3 or LysM) in addition to the GH25 domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHB51666.1	6.27e-219	1	312	1	312
QIR08946.1	9.96e-216	1	312	1	312
QEU39757.1	2.51e-215	1	312	26	337
QGV25234.1	2.09e-118	4	310	9	306
AQW20679.1	3.53e-117	9	310	10	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3HMC_A	3.87e-22	34	221	7	189	Endolysinfrom Bacillus anthracis [Bacillus anthracis]
2NW0_A	2.61e-21	34	222	3	185	ChainA, PlyB [Bacteriophage sp.],2NW0_B Chain B, PlyB [Bacteriophage sp.]
4JZ5_A	2.95e-12	36	208	27	208	High-resolutionstructure of catalytic domain of endolysin ply40 from bacteriophage P40 of Listeria monocytogenes [Listeria phage P40]
4KRU_A	8.79e-06	36	192	24	181	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.999018	0.000172	0.000181	0.000151	0.000139

TMHMM  Annotations     

start	end
7	24