CAZyme Information: MGYG000001333.1_01508

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_01508
• CAZy Family: GH73
• CAZyme Description: Exo-glucosaminidase LytG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210	MGYG000001333.1_104|CGC5	23894.02	9.6889

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 524869; End: 525501 Strand: +

Full Sequence      

MAKYNSRRKRRKQTSNLIVMLVLIGFGLFIILGFRLLSANVPESNQVDNARSELAAQHRK
FINKLAPQAQLLQGQYNVLPSVTLAQAILESNWGTSQLSSKYNNLFGVKAQSSNTKSVYL
DTQEYVDGRYVTVKARFEVYDSWNDSLAEHAKLLAYGTKWNPDQYRDVVSANNYVQAAQG
LEKDGYATDPTYTEKLISLIKNYKLYQFDD

Enzyme Prediction     

No EC number prediction in MGYG000001333.1_01508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	66	205	2.4e-38	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	5.28e-64	18	210	3	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
smart00047	LYZ2	4.18e-36	58	209	8	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
PRK08581	PRK08581	5.03e-33	57	210	319	473	amidase domain-containing protein.
PRK05684	flgJ	1.40e-32	61	207	155	301	flagellar assembly peptidoglycan hydrolase FlgJ.
TIGR02541	flagell_FlgJ	1.42e-32	48	200	137	290	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIR09983.1	2.42e-147	1	210	1	210
QHB53436.1	2.26e-134	20	210	1	191
QEU39797.1	6.47e-134	20	210	1	191
APR07902.1	2.76e-105	1	210	1	210
QGV23956.1	2.26e-104	1	210	1	210

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	1.12e-28	48	209	17	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5DN5_A	3.45e-20	59	204	4	149	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	4.90e-20	59	204	4	149	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5T1Q_A	1.20e-19	59	210	61	213	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
3VWO_A	1.16e-16	61	207	4	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	1.87e-41	8	210	3	199	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9CIT4	4.39e-23	61	209	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	2.13e-22	61	209	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	7.58e-22	61	209	65	214	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1
P75942	7.99e-20	49	204	140	295	Peptidoglycan hydrolase FlgJ OS=Escherichia coli (strain K12) OX=83333 GN=flgJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999991	0.000019	0.000000	0.000000	0.000000	0.000030

TMHMM  Annotations     

start	end
17	39