CAZyme Information: MGYG000001333.1_00652

Basic Information

• Species: Lentilactobacillus hilgardii
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Lentilactobacillus; Lentilactobacillus hilgardii
• CAZyme ID: MGYG000001333.1_00652
• CAZy Family: GH51
• CAZyme Description: Intracellular exo-alpha-(1->5)-L-arabinofuranosidase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
329	MGYG000001333.1_102|CGC1	37559.73	7.3209

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001333.1	3077266	Isolate	not provided	not provided

• Gene Location: Start: 397445; End: 398434 Strand: -

Full Sequence      

MKATLKVDPSNQISKIDERIYGSFIEQLGRAVYEGIYQPGQSTADNDGLRRDVIDAIKKL
NIPIVRYPGGNFVSQYKWEDGIGPKDARPTRLDLAWRSIETNQFGLHEFMNWADKVGTKA
DMAVNLGTRGIMAAANLVEYCNFPKGSYWSDLRRQNGQEQPYNIKTWCLGNEMDGPWEIG
QKTAYEYGHLANEAAKAMLAVDDSIELVACGSSSMDNPTFGDWEKTVLDQCYDNVDYLSL
HRYYGFYGDDDPNELDNYLGKNIDLDEFIKGVVAICDAVKARKRTKKQLIYRLMSGTFGI
IQMTKMPKRRLGRRHHTFWKMSIILKMHC

Enzyme Prediction     

EC	3.2.1.55

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH51	2	282	7.1e-92	0.4174603174603175

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3534	AbfA	3.21e-149	1	287	2	284	Alpha-L-arabinofuranosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMS07374.1	2.67e-186	1	289	1	289
AKP64943.1	2.62e-169	1	289	1	289
ARN89204.1	2.07e-166	1	289	1	289
AJA80585.1	2.07e-166	1	289	1	289
QCZ49449.1	2.07e-166	1	289	1	289

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PZ3_A	6.72e-134	2	289	5	288	Crystalstructure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],1PZ3_B Crystal structure of a family 51 (GH51) alpha-L-arabinofuranosidase from Geobacillus stearothermophilus T6 [Geobacillus stearothermophilus],6SXU_AAA Chain AAA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXU_BBB Chain BBB, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Geobacillus stearothermophilus],6SXV_A GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus],6SXV_B GH51 a-l-arabinofuranosidase soaked with aziridine inhibitor [Geobacillus stearothermophilus]
1PZ2_A	5.43e-133	2	289	5	288	ChainA, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1PZ2_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW8_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_A Chain A, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus],1QW9_B Chain B, Alpha-L-arabinofuranosidase [Geobacillus stearothermophilus]
5O7Z_A	1.58e-129	2	289	2	285	ChainA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O7Z_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_A Chain A, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O80_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila]
2C7F_A	2.29e-129	2	289	13	296	ChainA, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_B Chain B, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_C Chain C, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_D Chain D, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_E Chain E, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C7F_F Chain F, Alpha-l-arabinofuranosidase [Acetivibrio thermocellus],2C8N_A Chain A, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_B Chain B, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_C Chain C, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_D Chain D, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_E Chain E, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus],2C8N_F Chain F, ALPHA-L-ARABINOFURANOSIDASE [Acetivibrio thermocellus]
5O81_A	1.27e-128	2	289	2	285	ChainA, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O81_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O81_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O81_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O81_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O81_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_A Chain A, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_B Chain B, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_C Chain C, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_D Chain D, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_E Chain E, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila],5O82_F Chain F, Intracellular exo-alpha-(1->5)-L-arabinofuranosidase [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KBR4	2.44e-133	1	289	3	287	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Alkalihalobacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) OX=272558 GN=abfA PE=3 SV=1
P94531	3.45e-133	2	289	3	286	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase 1 OS=Bacillus subtilis (strain 168) OX=224308 GN=abfA PE=1 SV=2
Q9XBQ3	3.68e-133	2	289	5	288	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Geobacillus stearothermophilus OX=1422 GN=abfA PE=1 SV=4
A3DIH0	1.14e-129	2	289	3	286	Intracellular exo-alpha-(1->5)-L-arabinofuranosidase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=Cthe_2548 PE=1 SV=1
E7CY70	4.71e-106	2	286	15	301	Exo-alpha-(1->6)-L-arabinofuranosidase OS=Bifidobacterium longum OX=216816 GN=afuB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001333.1_00652.