CAZyme Information: MGYG000001330_01290

Basic Information

• Species: Helicobacter_D winghamensis
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D winghamensis
• CAZyme ID: MGYG000001330_01290
• CAZy Family: GT56
• CAZyme Description: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
356		42475.48	8.5771

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001330	1654872	Isolate	not provided	not provided

• Gene Location: Start: 248342; End: 249412 Strand: -

Full Sequence      

MKMLHIVVYEDKFTPQLIYKLNTYFADKKTFYVLVDKKGRKEFPKELLAYDNVMIYQGIK
DFWKLLKIASGARVVVYNALFYRFFLQMQLLACAIFKPKVWIVWSADMYLRDCSNLLKKL
YNRFLVSRFAYLATPIEGDFANYQKIWGFGAKNLRFFFPFSQDILKIPLTQKESQTTWIQ
VGNSGHFTNRHLEVLEMLKCYKDKDIKIVIPLSYGCNKDYQQSVESAYREVFGEEKIWIL
KENLPFVEYVKLLGYIDIGIFHHFVQEAGHNVMLLEAFGKKCYICSQNTLYNMSKVVFNV
KVFRTEDLENSPFEEFIAWDSKDSRENMEKMRYFVSDEFFKDEIEKFYDVLQKEIQ

Enzyme Prediction     

No EC number prediction in MGYG000001330_01290.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT56	75	313	4e-43	0.6778711484593838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK02797	PRK02797	1.31e-36	83	307	42	277	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase.
pfam07429	Glyco_transf_56	6.25e-18	83	288	81	298	4-alpha-L-fucosyltransferase glycosyl transferase group 56. This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (EC 2.4.1.-) (approximately 360 residues long). This catalyzes the synthesis of Fuc4NAc-ManNAcA-GlcNAc-PP-Und (lipid III) as part of the biosynthetic pathway of enterobacterial common antigen (ECA), a polysaccharide comprised of the trisaccharide repeat unit Fuc4NAc-ManNAcA-GlcNAc.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOQ97877.1	1.77e-263	1	356	1	356
AZV47328.1	3.01e-37	5	348	4	332
QQK59346.1	2.12e-35	2	350	4	346
BAF72501.1	3.64e-32	2	349	5	353
ABX31658.1	6.50e-31	2	329	5	330

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1CNJ1	1.77e-15	101	291	108	301	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=wecF PE=3 SV=1
B2K058	1.77e-15	101	291	108	301	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) OX=502801 GN=wecF PE=3 SV=1
Q1CBP2	1.77e-15	101	291	108	301	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=wecF PE=3 SV=1
A4TRB6	1.77e-15	101	291	108	301	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pestis (strain Pestoides F) OX=386656 GN=wecF PE=3 SV=1
Q66G07	1.77e-15	101	291	108	301	TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=wecF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001330_01290.