CAZyme Information: MGYG000001329_01194

Basic Information

• Species: Helicobacter_A rappini
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_A; Helicobacter_A rappini
• CAZyme ID: MGYG000001329_01194
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		44427.01	9.4109

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001329	2523721	Isolate	not provided	not provided

• Gene Location: Start: 1210; End: 2358 Strand: +

Full Sequence      

MQNITTNKDLITKSSTKELKIFVSALEPSSNLHLRNLAKVLPESCTLIGVCESEIGRQVL
SPSEFAIMGFSDVAKKILFFKEAMQILSEAALTCDKILLMDSSSFHLRLAKKIREKNPNI
PIMYYILPQVWAWKEWRAKEIERLFDKLACIWPFELHYYEKKARYVGHPLLDIYTESKQF
YSKDSNIFVFMPGSRKSEIKKLMNDYRILAKKLLEKHENAILRLIIPEKFRDTKMMEIYG
DTDMFHIVYNTQEGLSNASFAFVCAGTATLEASLMQIPFVLVYRAKWIDYFIARMFVKLN
FVGLANIIYQAMLKENGKNIKKAGLGDDYLHEELLQKDCNAKNMLKAYENFNYQKYFEGT
STLRKYLKHGSKDNVAKWLLEP

Enzyme Prediction     

EC	2.4.1.182

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	21	353	1.9e-85	0.9378531073446328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK14089	PRK14089	3.29e-162	20	382	3	347	lipid-A-disaccharide synthase.
COG0763	LpxB	9.26e-88	19	381	2	377	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
TIGR00215	lpxB	3.31e-80	21	372	8	376	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
pfam02684	LpxB	1.41e-73	21	371	1	369	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK00025	lpxB	6.83e-57	19	381	2	373	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQQ60198.1	1.01e-273	1	382	1	382
AFI05391.1	5.94e-103	21	377	4	351
AFI04277.1	8.40e-103	21	377	4	351
QEE95882.1	1.27e-102	21	376	4	350
QEF40998.1	1.80e-102	21	376	4	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	8.83e-19	95	347	92	340	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.20e-18	95	347	92	340	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5Z7M7	7.20e-103	21	376	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain G27) OX=563041 GN=lpxB PE=3 SV=1
Q9ZKY2	1.44e-102	21	377	4	351	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) OX=85963 GN=lpxB PE=3 SV=1
O25537	1.44e-102	21	376	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=lpxB PE=3 SV=1
B2USW3	6.59e-101	21	376	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain Shi470) OX=512562 GN=lpxB PE=3 SV=1
Q1CT05	6.59e-101	21	376	4	350	Lipid-A-disaccharide synthase OS=Helicobacter pylori (strain HPAG1) OX=357544 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001329_01194.