CAZyme Information: MGYG000001323_01020

Basic Information

• Species: Providencia rettgeri_D
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Providencia; Providencia rettgeri_D
• CAZyme ID: MGYG000001323_01020
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
208	MGYG000001323_27|CGC1	23273.52	9.3792

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001323	4749568	Isolate	not provided	not provided

• Gene Location: Start: 107568; End: 108194 Strand: +

Full Sequence      

MLLLLAGCSSEPDRPVTKQRMLEPTGPIATQNTTFPRTPFDEFIRDSAVRYSVDEALIRA
IIEVESNFRPEVVSKSNAIGLMQIKASTAGRDAYRYQGKPGEPSTRDLKDPQKNIDIGTA
YIRILREQHLAGISHPQTLYYATVVAYVNGAGALLRTFDNDKGRAIAMINSLSPEEFYQH
VQTKHPAPQAPRYLWKVKNAYNALAMSY

Enzyme Prediction     

No EC number prediction in MGYG000001323_01020.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	54	204	1.3e-21	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	5.92e-83	42	202	1	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.08e-74	1	204	9	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	7.06e-65	43	200	195	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	2.93e-29	48	167	5	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	4.21e-29	44	200	143	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBV04858.1	3.74e-150	1	208	1	208
QNN31711.1	5.17e-150	1	208	10	217
QIF66299.1	5.17e-150	1	208	10	217
QLI97773.1	5.17e-150	1	208	10	217
BBV01887.1	5.17e-150	1	208	10	217

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	2.29e-58	51	204	33	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	3.03e-58	51	204	50	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	6.52e-58	51	204	33	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	6.52e-58	51	204	33	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	6.52e-58	51	204	33	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	1.55e-65	1	204	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	6.74e-62	1	204	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
A4WBE8	1.10e-60	1	204	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Enterobacter sp. (strain 638) OX=399742 GN=emtA PE=3 SV=1
B7LSJ1	6.28e-60	1	204	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CCUG 18766 / IAM 14443 / JCM 21226 / LMG 7866 / NBRC 102419 / NCTC 12128 / CDC 0568-73) OX=585054 GN=emtA PE=3 SV=1
C0Q334	6.28e-60	1	204	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000090	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001323_01020.