CAZyme Information: MGYG000001315_00958

Basic Information

• Species: Bariatricus comes
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bariatricus; Bariatricus comes
• CAZyme ID: MGYG000001315_00958
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000001315_4|CGC6	43114.09	8.8081

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001315	3238915	Isolate	not provided	not provided

• Gene Location: Start: 848711; End: 849901 Strand: +

Full Sequence      

MALNGIDIASYQTGIDLSVVPCDFVIVKATEGTGYVNPDFTRAYAQAKNAGKCLGIYHYA
TGGDYQKEADYFLDRIGKRVGEAILCLDWEGTGNPAFGSSDFAWCKSWLDYVYQKTGVRP
LLYCSQSVAYKFANIGNCGLWIAQYADMNATGYQDKPWNEGAYTCAIRQYSSCGRLNGWG
GNLDLDKFYGDKDAWNKYAGKGNTTKPAETPKPTVNTPSGSTLDLVVGVMQGKYGAGDNR
KNALGTRYNEVQSFIDHIYSASVDTLVNEVKAGKYGNGDTRKVVLGSRYTEVQNKINAAS
ARKSNEQIAQEVLAGKWGNGNDRKNRLSAAGYDYNTIQNIVNGKSGASSAQYYTVQSGDT
LSGIAAKYGTSYQKVAQLNGLSNPNMIYAGQRLRVK

Enzyme Prediction     

No EC number prediction in MGYG000001315_00958.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	6	178	1.7e-40	0.9887005649717514
CBM50	353	395	5.6e-16	0.95

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06417	GH25_LysA-like	2.81e-88	3	195	1	195	LysA is a cell wall endolysin produced by Lactobacillus fermentum, which degrades bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. The N-terminal glycosyl hydrolase family 25 (GH25) domain of LysA has sequence similarity with other murein hydrolase catalytic domains while the C-terminal domain has sequence similarity with putative bacterial cell wall-binding SH3b domains. This domain family also includes LysL of Lactococcus lactis.
cd00599	GH25_muramidase	1.83e-39	5	188	2	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
pfam01183	Glyco_hydro_25	2.65e-34	6	179	1	180	Glycosyl hydrolases family 25.
cd06525	GH25_Lyc-like	1.77e-27	4	188	1	184	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
cd06524	GH25_YegX-like	2.67e-23	5	190	2	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT50187.1	4.18e-264	1	396	1	396
QRT50341.1	4.07e-137	1	396	1	346
CBK80688.1	6.62e-96	1	396	1	362
CBK82001.1	1.07e-77	3	262	12	283
QHJ76374.1	3.33e-76	3	390	1	371

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1JFX_A	7.21e-11	3	190	5	204	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
2WAG_A	1.14e-09	3	201	16	219	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
6ZMV_A	1.44e-08	2	184	1	198	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]
6ZM8_A	4.85e-08	3	164	2	177	ChainA, muramidase [Sodiomyces alcalophilus]
2X8R_A	5.47e-07	3	123	4	137	Thestructure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_B The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_C The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_D The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_E The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293],2X8R_F The structure of a family GH25 lysozyme from Aspergillus fumigatus [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00721	3.74e-12	3	127	2	142	N,O-diacetylmuramidase OS=Chalaropsis sp. OX=36534 PE=1 SV=1
Q49UX4	1.50e-10	353	395	88	129	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1
Q8FFY2	5.67e-10	3	190	67	256	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
Q8X7H0	7.63e-10	3	193	67	259	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	9.25e-10	3	190	82	281	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001315_00958.