CAZyme Information: MGYG000001314_01462

Basic Information

• Species: Bacteroides_F pectinophilus
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Bacteroides_F; Bacteroides_F pectinophilus
• CAZyme ID: MGYG000001314_01462
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154		17273.32	10.4

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001314	3025526	Isolate	not provided	not provided

• Gene Location: Start: 970742; End: 971206 Strand: -

Full Sequence      

MALTRRKKRRIRRIILAVLGIIICIAAVISLPTVMKVLKLRNEAVAIAAKSKADDFKSTQ
TTVAYDSKGSVLLTMRASKDMYYVTYSEIPQVIKDAFVVTEDKKFYSHKGIDYFSILRAI
IANQKSDEIEQGASTITQQLARNVYLKQEVTVGP

Enzyme Prediction     

No EC number prediction in MGYG000001314_01462.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	71	152	1.6e-26	0.4519774011299435

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	3.42e-30	83	152	15	84	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	7.10e-27	60	152	47	138	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	1.12e-24	44	152	38	148	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
PRK11636	mrcA	2.23e-17	84	152	69	137	penicillin-binding protein 1a; Provisional
PRK00056	mtgA	1.44e-16	84	146	63	125	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR72912.1	1.98e-35	31	151	36	156
CUH93821.1	1.67e-29	38	151	49	163
BCN28959.1	2.50e-29	15	149	33	168
AQP39446.1	2.70e-25	36	151	50	166
CBL38788.1	5.01e-25	36	151	50	166

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.12e-17	66	152	6	91	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.57e-17	66	152	6	91	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
5U2G_A	5.74e-14	84	152	43	111	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
5FGZ_A	3.60e-13	72	149	144	224	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.61e-13	72	149	165	245	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40750	6.08e-18	55	149	49	144	Penicillin-binding protein 4 OS=Bacillus subtilis (strain 168) OX=224308 GN=pbpD PE=1 SV=2
O66874	1.58e-17	60	152	43	134	Penicillin-binding protein 1A OS=Aquifex aeolicus (strain VF5) OX=224324 GN=mrcA PE=1 SV=1
Q07259	4.14e-15	83	151	49	116	Putative transglycosylase H16_A0665 OS=Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) OX=381666 GN=H16_A0665 PE=3 SV=2
Q891X1	5.65e-15	59	152	58	155	Penicillin-binding protein 1A OS=Clostridium tetani (strain Massachusetts / E88) OX=212717 GN=pbpA PE=3 SV=1
P39793	7.83e-15	57	152	72	166	Penicillin-binding protein 1A/1B OS=Bacillus subtilis (strain 168) OX=224308 GN=ponA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.988411	0.002254	0.000569	0.000024	0.000011	0.008752

TMHMM  Annotations     

start	end
13	35