CAZyme Information: MGYG000001312_00062

Basic Information

• Species: Helicobacter_D pullorum
• Lineage: Bacteria; Campylobacterota; Campylobacteria; Campylobacterales; Helicobacteraceae; Helicobacter_D; Helicobacter_D pullorum
• CAZyme ID: MGYG000001312_00062
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
184	MGYG000001312_37|CGC1	21062.83	6.956

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000001312	1919109	Isolate	not provided	not provided

• Gene Location: Start: 7866; End: 8420 Strand: -

Full Sequence      

MIDIALIEQCKNPNVETQIIQKIIQIESNNQQFAININKVGSFMLKTKKEAENLANNFIK
GGYSVDIGLMQFNSNNLKSSTFSHYSVEDLLDTCKNIKAGSDIFYLAYEATDEKLSKEER
INQALSIYNTGNLEDGFNNGYVAKYNYISPNINLLEKARKSETRIEIKFQPFNLQTQKRI
QNDK

Enzyme Prediction     

No EC number prediction in MGYG000001312_00062.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16892	LT_VirB1-like	1.58e-39	6	145	1	138	VirB1-like subfamily. This subfamily includes VirB1 protein, one of twelve proteins making up type IV secretion systems (T4SS). T4SS are macromolecular assemblies generally composed of VirB1-11 and VirD4 proteins, and are used by bacteria to transport material across their membranes. VirB1 acts as a lytic transglycosylase (LT), and is important with respect to piercing the peptidoglycan layer in the periplasm. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria, the LTs in bacteriophage lambda, as well as the eukaryotic "goose-type" lysozymes (goose egg-white lysozyme; GEWL).
PRK13864	PRK13864	2.33e-14	13	144	39	168	type IV secretion system lytic transglycosylase VirB1; Provisional
cd13403	MLTF-like	4.47e-06	67	135	36	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13400	LT_IagB-like	6.46e-06	27	144	15	102	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	4.75e-05	66	148	35	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA55124.1	1.49e-126	1	184	1	184
AVS39845.1	4.99e-125	1	184	1	184
ALV00800.1	6.35e-100	1	179	1	180
APA58741.1	6.35e-100	1	179	1	180
AGZ22107.1	6.35e-100	1	179	1	180

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0A3V6	6.41e-10	13	144	39	168	Protein virB1 OS=Rhizobium radiobacter OX=358 GN=virB1 PE=3 SV=1
P0A3V7	6.41e-10	13	144	39	168	Protein virB1 OS=Agrobacterium tumefaciens (strain 15955) OX=190386 GN=virB1 PE=3 SV=1
P17791	1.17e-08	13	144	39	168	Protein virB1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=virB1 PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000001312_00062.